DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34461 and Ccp84Af

DIOPT Version :10

Sequence 1:NP_001097547.1 Gene:CG34461 / 5740547 FlyBaseID:FBgn0250833 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster


Alignment Length:158 Identity:64/158 - (40%)
Similarity:86/158 - (54%) Gaps:32/158 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KYFVAIALLFAAAQAV-PI-ELGHYAPALVHHAPVLSHAVHAVHAEPV---------AYPKYSFN 55
            |:|..:||:.||:..| |: ::.|.|||:..:|..   .|...||:||         .:|:|.|.
  Fly     4 KFFAVLALISAASAGVLPVQQVYHAAPAVATYAQA---PVAVAHAQPVLTKATEEYDPHPQYKFA 65

  Fly    56 YGIKDPHTGDIKSQAEERDGDVVKGQYSLVEPDGSVRTVDYTADDHNGFNAVVH----------- 109
            |.::|..:||.|||.||||||||.|:|||::.||..|.|.||:|..|||||||:           
  Fly    66 YDVQDSLSGDSKSQVEERDGDVVHGEYSLIDSDGYKRIVQYTSDPVNGFNAVVNRVPLDHVKTVV 130

  Fly   110 KTAPSKIIAHAPVLHAAPVLAHAPLLHH 137
            ||.....:|.||:    ||..|.   ||
  Fly   131 KTVAPVAVAAAPI----PVAYHQ---HH 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34461NP_001097547.1 Chitin_bind_4 52..104 CDD:459790 29/51 (57%)
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:459790 29/51 (57%)

Return to query results.
Submit another query.