DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34461 and Cpr76Bd

DIOPT Version :9

Sequence 1:NP_001097547.1 Gene:CG34461 / 5740547 FlyBaseID:FBgn0250833 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_001262052.1 Gene:Cpr76Bd / 40123 FlyBaseID:FBgn0036881 Length:1231 Species:Drosophila melanogaster


Alignment Length:125 Identity:60/125 - (48%)
Similarity:73/125 - (58%) Gaps:26/125 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PIELGHY-----APALVHHAPVLS-----------HAV-------HAVHAEPVAYPKYSFNYGIK 59
            |:..|.|     .|||..||||.:           |||       |..|.:  |:|:|:|.|.:.
  Fly  1101 PLGAGFYRYAPSVPALSSHAPVAATAYLKSAPVTQHAVLKVVPEKHLEHFD--AHPRYAFEYAVN 1163

  Fly    60 DPHTGDIKSQAEERDGDVVKGQYSLVEPDGSVRTVDYTADDHNGFNA-VVHKTAPSKIIA 118
            ||||||.|.|.||||||||||:||||||||:||||.|.||...||:| |::.....||:|
  Fly  1164 DPHTGDNKHQKEERDGDVVKGEYSLVEPDGNVRTVKYYADWETGFHAEVINSRDQGKIVA 1223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34461NP_001097547.1 Chitin_bind_4 52..104 CDD:278791 36/51 (71%)
Cpr76BdNP_001262052.1 Chitin_bind_4 1156..1208 CDD:278791 36/51 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D634603at33208
OrthoFinder 1 1.000 - - FOG0017018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.