DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34461 and Lcp65Ac

DIOPT Version :10

Sequence 1:NP_001097547.1 Gene:CG34461 / 5740547 FlyBaseID:FBgn0250833 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_477279.1 Gene:Lcp65Ac / 38708 FlyBaseID:FBgn0020642 Length:109 Species:Drosophila melanogaster


Alignment Length:103 Identity:33/103 - (32%)
Similarity:47/103 - (45%) Gaps:17/103 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IALLFAAAQAVPIELGHYAPALVHHAPVLSHAVHAVHAEPVAYPK-YSF----NYGIKDPHTGDI 66
            :|::|.|..||           |..||........:..|....|: |:|    :.|.|....|.:
  Fly     5 VAIVFTALFAV-----------VLAAPAPDADTQILRLESDVQPEGYNFALETSDGKKHEEQGQL 58

  Fly    67 KSQAEERDGDVVKGQYSLVEPDGSVRTVDYTADDHNGF 104
            |:...|::..||:|.||.|..||...||:|.||: |||
  Fly    59 KNVGTEQEAIVVRGSYSFVADDGQTYTVNYIADE-NGF 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34461NP_001097547.1 Chitin_bind_4 52..104 CDD:459790 21/55 (38%)
Lcp65AcNP_477279.1 Chitin_bind_4 40..95 CDD:459790 21/55 (38%)

Return to query results.
Submit another query.