DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34461 and Cpr64Ab

DIOPT Version :10

Sequence 1:NP_001097547.1 Gene:CG34461 / 5740547 FlyBaseID:FBgn0250833 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_647873.2 Gene:Cpr64Ab / 38509 FlyBaseID:FBgn0035511 Length:120 Species:Drosophila melanogaster


Alignment Length:91 Identity:50/91 - (54%)
Similarity:63/91 - (69%) Gaps:6/91 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 VHAEPVAYPKYSFNYGIKDPHTGDIKSQAEERDGDVVKGQYSLVEPDGSVRTVDYTADDHNGFNA 106
            ::.|...:|:|:|.|.::|..|||.|||.|.||||||||.||:|:.|||:|||.||||..|||||
  Fly    32 LNTEVDPHPQYAFAYNVQDALTGDSKSQQEVRDGDVVKGSYSVVDADGSLRTVFYTADPINGFNA 96

  Fly   107 VVHKTAPSKIIAH---APVLHAAPVL 129
            ||.: .|..:.|.   |||  |||:|
  Fly    97 VVQR-GPVPVAARPLVAPV--AAPIL 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34461NP_001097547.1 Chitin_bind_4 52..104 CDD:459790 33/51 (65%)
Cpr64AbNP_647873.2 Chitin_bind_4 42..94 CDD:459790 33/51 (65%)

Return to query results.
Submit another query.