DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34461 and Cpr62Bc

DIOPT Version :9

Sequence 1:NP_001097547.1 Gene:CG34461 / 5740547 FlyBaseID:FBgn0250833 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_001261293.1 Gene:Cpr62Bc / 38241 FlyBaseID:FBgn0035281 Length:180 Species:Drosophila melanogaster


Alignment Length:148 Identity:81/148 - (54%)
Similarity:100/148 - (67%) Gaps:17/148 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KYFVAIALLFAAAQAVPIELGHYAPALVHHAPVLSHAVHAVHAEPV---AYPKYSFNYGIKDPHT 63
            |..:.:|:|.||:..|   |..:...|...||.: :|.|..|.|.:   |||||.:|||:.|.||
  Fly     5 KSLICLAVLSAASAGV---LHGHGAGLYAAAPAI-YAGHGHHDEGIDYHAYPKYHYNYGVADSHT 65

  Fly    64 GDIKSQAEERDGDVVKGQYSLVEPDGSVRTVDYTADDHNGFNAVVHKTAPS------KIIAHA-- 120
            ||:|||.|.||||||||.|||||||||||||:||||||||||||||||.|:      .::|||  
  Fly    66 GDVKSQHEVRDGDVVKGSYSLVEPDGSVRTVEYTADDHNGFNAVVHKTGPTVHHAAPAVVAHAAP 130

  Fly   121 PVLHAAPVLAHAPLLHHY 138
            .|:||||  |:||.:.|:
  Fly   131 AVVHAAP--AYAPAIAHH 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34461NP_001097547.1 Chitin_bind_4 52..104 CDD:278791 41/51 (80%)
Cpr62BcNP_001261293.1 Chitin_bind_4 54..106 CDD:395303 41/51 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D130248at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.