DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34461 and CG42367

DIOPT Version :9

Sequence 1:NP_001097547.1 Gene:CG34461 / 5740547 FlyBaseID:FBgn0250833 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_723502.2 Gene:CG42367 / 318998 FlyBaseID:FBgn0259713 Length:103 Species:Drosophila melanogaster


Alignment Length:112 Identity:44/112 - (39%)
Similarity:60/112 - (53%) Gaps:18/112 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VAIALLFAAAQAVPIELGHYAPALVHHAPVLSHAVHAVHAEPVAYP-KYSFNYGIKDPHTGDIKS 68
            :.|.|:.:|..||...:            :.||.     .|.:|.| :|.|:|.:.|.|:||:|.
  Fly     8 IVICLILSALVAVQAGI------------IASHP-----DELIASPAQYEFHYSVHDSHSGDVKD 55

  Fly    69 QAEERDGDVVKGQYSLVEPDGSVRTVDYTADDHNGFNAVVHKTAPSK 115
            |.|.|.|:.|.|:||||:|||..|.||||||...||||.|.:...|:
  Fly    56 QFEHRRGEYVTGRYSLVDPDGHRRIVDYTADPLLGFNAQVRREPISR 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34461NP_001097547.1 Chitin_bind_4 52..104 CDD:278791 28/51 (55%)
CG42367NP_723502.2 Chitin_bind_4 39..86 CDD:278791 26/46 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.