DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15140 and CG43894

DIOPT Version :9

Sequence 1:NP_001097171.2 Gene:CG15140 / 5740546 FlyBaseID:FBgn0032631 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001034004.1 Gene:CG43894 / 39464 FlyBaseID:FBgn0264486 Length:235 Species:Drosophila melanogaster


Alignment Length:60 Identity:29/60 - (48%)
Similarity:38/60 - (63%) Gaps:0/60 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QLFSICLLIATVVNVHGFSKYGRDCRDILCAPGQKCIISRDPCSGSNKLENTQCGKYPTC 62
            :|..|.|::||.:.|.|:.|:|..|.||.|..|:|||:||.||...|:.|..|||.||.|
  Fly     2 ELVGIYLILATTIVVQGYRKFGLSCEDIACISGKKCIVSRVPCENPNQQEGEQCGTYPEC 61



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0019436
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR39956
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.