powered by:
Protein Alignment CG15140 and CG43894
DIOPT Version :9
Sequence 1: | NP_001097171.2 |
Gene: | CG15140 / 5740546 |
FlyBaseID: | FBgn0032631 |
Length: | 335 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001034004.1 |
Gene: | CG43894 / 39464 |
FlyBaseID: | FBgn0264486 |
Length: | 235 |
Species: | Drosophila melanogaster |
Alignment Length: | 60 |
Identity: | 29/60 - (48%) |
Similarity: | 38/60 - (63%) |
Gaps: | 0/60 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 QLFSICLLIATVVNVHGFSKYGRDCRDILCAPGQKCIISRDPCSGSNKLENTQCGKYPTC 62
:|..|.|::||.:.|.|:.|:|..|.||.|..|:|||:||.||...|:.|..|||.||.|
Fly 2 ELVGIYLILATTIVVQGYRKFGLSCEDIACISGKKCIVSRVPCENPNQQEGEQCGTYPEC 61
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0019436 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR39956 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.100 |
|
Return to query results.
Submit another query.