DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15140 and AT2G05580

DIOPT Version :9

Sequence 1:NP_001097171.2 Gene:CG15140 / 5740546 FlyBaseID:FBgn0032631 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_178626.1 Gene:AT2G05580 / 3768507 AraportID:AT2G05580 Length:302 Species:Arabidopsis thaliana


Alignment Length:302 Identity:133/302 - (44%)
Similarity:147/302 - (48%) Gaps:39/302 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KCIISRDPCS--GSNKLENTQ--CGKYPTCVMH--NHYSST----SGETLERGKRQANQQGYGMG 91
            |.:.|.|...  |.|::|.::  | ||..|..:  ||:..|    .||..|..|   |.||    
plant    22 KVVASIDDTKQVGENQVEESKSTC-KYGNCAQYGENHFVETDEVLDGEEEEESK---NNQG---- 78

  Fly    92 GSGMGRPNGMNNGGNGGNGMGGQYGNGMGGQ--NRNGMGGQ-----YGNGMGGQNGNGMGGNGMR 149
              |:||..|...|| ||.|.|||.|.|.|||  .:.|.|||     .|.|.|||.|.|.||.|.:
plant    79 --GIGRGQGGQKGG-GGGGQGGQKGGGGGGQGGQKGGGGGQGGQKGGGGGQGGQKGGGGGGQGGQ 140

  Fly   150 GNGMGPGGMGGRGGNGNGMGQGGMGGNGMGSGGMGGNGMGGNGMGGNGMGGNGMGGNGMGPGGMG 214
            ..| |.||.||:.|.|.| ||||..|.|...|..||.|.||. .||.|.||. .||.|.|.|||.
plant   141 KGG-GGGGQGGQKGGGGG-GQGGQKGGGGQGGQKGGGGQGGQ-KGGGGQGGQ-KGGGGRGQGGMK 201

  Fly   215 GNGMGGNGLGPGGMGGNGMGPGGMGGNGMGGQGGYNGRWGQNGMGGPNGMGGRNGMGRPNGMGGP 279
            |.|.||.|...||.||.|.| |..||.|.|||||:.| .|..|.||....||..|.|...|.|| 
plant   202 GGGGGGQGGHKGGGGGGGQG-GHKGGGGGGGQGGHKG-GGGGGQGGGGHKGGGGGQGGHKGGGG- 263

  Fly   280 PGGQNGMGGPPGGPNGMGPGNWQGNNNWGNGNNGNGSNRYGG 321
             ||..|.||..||..|.|.|   |:...|.|.:|.|....||
plant   264 -GGHVGGGGRGGGGGGRGGG---GSGGGGGGGSGRGGGGGGG 301



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.