DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15140 and CG32521

DIOPT Version :9

Sequence 1:NP_001097171.2 Gene:CG15140 / 5740546 FlyBaseID:FBgn0032631 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001259757.1 Gene:CG32521 / 33098 FlyBaseID:FBgn0052521 Length:388 Species:Drosophila melanogaster


Alignment Length:401 Identity:122/401 - (30%)
Similarity:151/401 - (37%) Gaps:119/401 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LFSICLLIATVVNVHGFSKYGRDCRDILCAPGQKCIISRDPCSGSNKLENTQCGKYPTC------ 62
            |.::.:|.:...:|..:|||||.|.||.|.|.::|:|:.|.|| .|:.:...||.||||      
  Fly     6 LLTLAVLASCGYSVDAYSKYGRGCGDIGCLPTEECVITSDSCS-YNQRDGKDCGNYPTCKRRSGG 69

  Fly    63 --------------------VMHNHYSSTSGETLERGKRQANQQGYGMGGSGMGRPNGMNNGGNG 107
                                |.||.|:..:.........:|:    ..||:|.|       |..|
  Fly    70 GSSASNSSPNLAAPSANPSEVSHNAYAPNAPSAPSAPLPEAD----ASGGAGYG-------GAAG 123

  Fly   108 GNGMGGQYGNGM--GGQ-------NRNGMGG------QYGNGMGGQNGNGMGGNGMRG------- 150
            |.|.|| ||.|.  ||.       |.||.||      .||:| ||..|.| |.|...|       
  Fly   124 GGGSGG-YGGGFSAGGHSLYPSLPNSNGGGGGAAPYNPYGSG-GGNGGYG-GYNPYNGGYQPPSS 185

  Fly   151 ---NGMGPGGMGGRGG----------NGNGMGQ------GGMGGN-------------------- 176
               ....|||...|.|          ||.|..|      ||...|                    
  Fly   186 GGYQPQAPGGYQPRPGYTPPAPGYDNNGGGGAQKPKDKEGGFFSNFFSNPAVSQAVSGIIAGQIA 250

  Fly   177 -GMGSGGMGGNGMGGNGMGGNGMGGNGMGGNGMGPGGMGGNGMGGNGLG---PGGMGGNGMGPGG 237
             .:..||.||.| ||...||....|...||...|.||.||:.:.|..||   .||.|||....||
  Fly   251 KQLQGGGAGGPG-GGQPAGGYQPSGGYGGGPAAGGGGSGGSNILGGLLGSVLSGGGGGNAGAGGG 314

  Fly   238 MGGNGMGG--QGGYNGRWGQNGMGGPNGMG----GRNGMG----RPNGMGGPPGGQNGMGGPPGG 292
            ...:.:|.  .||.:.|..|.|.||..|:|    .:|..|    .|:...|.|...:. ||..|.
  Fly   315 SASSFLGSLLSGGNSNRGAQQGGGGSGGLGDIFSSKNFGGLFSENPSSRSGSPSSSSD-GGAKGY 378

  Fly   293 PNGMGPGNWQG 303
            |. ..|||:.|
  Fly   379 PT-QAPGNYYG 388



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR39956
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.