DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment futsch and Bdp1

DIOPT Version :9

Sequence 1:NP_001096864.1 Gene:futsch / 5740544 FlyBaseID:FBgn0259108 Length:5495 Species:Drosophila melanogaster
Sequence 2:NP_001186124.1 Gene:Bdp1 / 294687 RGDID:1308512 Length:310 Species:Rattus norvegicus


Alignment Length:343 Identity:82/343 - (23%)
Similarity:130/343 - (37%) Gaps:75/343 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly  2133 AEKSPLPSKEASRPASVAESIKDEAEKSKEESRRESVAEKSPLPSKEASRPASVAESIKDEAEKS 2197
            |..:|....||.||   .|.....|.|..|.:...:|......|.::|  |.|      ...||:
  Rat    23 AAPNPQRGPEAPRP---PEPATGSAPKPAEPTDVPAVDSGGAEPQEQA--PGS------SNNEKT 76

  Fly  2198 KEESRRESVAEKSPLPSKEASRPASVAESIKDEAEKSKEESRRESVAEKSPLPSKEASRPASVAE 2262
            .:.|   :|.|.|.|||..:.|              .|..|...|:.: .|:.:...|||.|.. 
  Rat    77 GDGS---NVEESSTLPSAASQR--------------RKRVSGTSSLGQ-PPVSAPSQSRPLSTV- 122

  Fly  2263 SIKDEAEKSKEESRRESVAEKSPLPSKEASRPASVAESI---KDEAEKSKEETRRESVAEKSPLP 2324
                          .....:.:|.|:|| .:|.|....|   :...|..|||.|:|....|:...
  Rat   123 --------------NHDAPQPNPTPAKE-KQPCSDRYRIYKARKLREMLKEELRKEKKQWKNKFA 172

  Fly  2325 SKEASRPASVAE-SIKD------EAEKSKEESRRESAAEKS--PLPSKE----ASRPASVAESVK 2376
            :.|:.||...:: :::|      ::........:|...|||  |.|::|    :::.|:..|.|:
  Rat   173 TNESQRPPDRSKMTMRDFIYYLPDSNPMTSSVEQEKKCEKSLAPTPTREQENQSTQDANDNEDVE 237

  Fly  2377 DEADKSKEESRRESMAESGKAQSIKGDQSPLKEVSRPESVAESVKDDPVKSKEPSRRESVAGSVT 2441
            :|.|.......|..:||.|..  |..::|...||.|.:......::||:..:         ||.|
  Rat   238 EEVDDGPLLVPRVKVAEDGSI--ILDEESLTVEVLRTKGPCVVEENDPIFER---------GSTT 291

  Fly  2442 A-DSARDD--QSPLESKG 2456
            . .|.|.:  ..|..:||
  Rat   292 TYSSFRKNYYSKPWSNKG 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
futschNP_001096864.1 DUF966 <1925..>2112 CDD:283735
Bdp1NP_001186124.1 DUF4551 60..>164 CDD:291746 34/145 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.