DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment futsch and RGD1306441

DIOPT Version :9

Sequence 1:NP_001096864.1 Gene:futsch / 5740544 FlyBaseID:FBgn0259108 Length:5495 Species:Drosophila melanogaster
Sequence 2:NP_001099523.1 Gene:RGD1306441 / 290425 RGDID:1306441 Length:274 Species:Rattus norvegicus


Alignment Length:257 Identity:53/257 - (20%)
Similarity:105/257 - (40%) Gaps:71/257 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   950 KKLQDLTASQELDAEKQRELDDLKEEQEVVR----------------------EIEAVFSRDEMK 992
            |||:.  .||:::.:..||...|::|...:|                      :.:.:..|:.:.
  Rat    28 KKLKH--KSQDVEKKLCRENKVLRDENRALRKDNKFLWGENKALGRENKTFRMDNQFIRERNHIL 90

  Fly   993 RQQHQ---QIKAELREMP-----------AEGTGD-GENEPDEEEEYLIIEKEEVEQYTEDSIVE 1042
            |||:|   ::|..:.|.|           .||... .:|...|.:...:.::|:..|....::.|
  Rat    91 RQQNQLLRKVKRLISENPKLSGEECNALNTEGRSFWQQNRAMEAQITALRQQEKAFQNEAKALHE 155

  Fly  1043 QESSMTKEEEIQKHQRDSQESEKK----------------RKKSAEEEIEAAIAKVEAA---ERK 1088
            :..|:.:|.:..:||..:...|:|                ::.:|.|..|.|:.|.|.|   |.|
  Rat   156 EIKSLCEETKALQHQERALRMEEKALLRDGVAAELAEALTKEGAALEMEEQALWKEEQALREENK 220

  Fly  1089 ARLEGASARQDESELDVEPEQSKIKAEVQDIIATAKDIAKSRTEEQLAKPAEEELSSPTPEE 1150
            |..|...|.||| |:.:: |:::|..|..:::           :.::.....|.:::..||:
  Rat   221 ALREEHGALQDE-EVALQ-EEARILQEWNNLL-----------QGKITNNLPENMNNQDPEK 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
futschNP_001096864.1 DUF966 <1925..>2112 CDD:283735
RGD1306441NP_001099523.1 SMC_prok_A <83..>245 CDD:274009 39/163 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3592
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.