DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34354 and HNRNPDL

DIOPT Version :9

Sequence 1:NP_001097953.2 Gene:CG34354 / 5740528 FlyBaseID:FBgn0085383 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_112740.1 Gene:HNRNPDL / 9987 HGNCID:5037 Length:420 Species:Homo sapiens


Alignment Length:398 Identity:92/398 - (23%)
Similarity:150/398 - (37%) Gaps:112/398 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PTIAMGAPQITMGPHKPPET-----KLLAIHPAAAAAAAAQQQQQ------SVTAAHLQHNGQQQ 65
            |:...|...|..|..:.|:.     |..:|..:||||||.:..:|      |||...:     .:
Human    66 PSRLAGGAAIKGGRRRRPDLFRRHFKSSSIQRSAAAAAATRTARQHPPADSSVTMEDM-----NE 125

  Fly    66 HSQQQQQQQMSQQQQQQQQQLVGNNSKPEQFHIFVGDLSAEIETQQLKDAFTPFGEISDCRVVRD 130
            :|..::..:.|:....:.||..|.        :|:|.||.:...:.|.:..:.|||:.||.:..|
Human   126 YSNIEEFAEGSKINASKNQQDDGK--------MFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTD 182

  Fly   131 PQTLKSKGYGFVSFVKKSEAETAITAMNGQWLGSRSIRTNWATRKPPATKADMNAKPLTFDEVYN 195
            |.|.:|:|:|||.| |.:.:...:..:....|..:.|       .|...||....:|        
Human   183 PVTGRSRGFGFVLF-KDAASVDKVLELKEHKLDGKLI-------DPKRAKALKGKEP-------- 231

  Fly   196 QSSPTNCTVYCGGINGALSGFLNEEILQKTFSPYGTIQEIRVFKD------KGYAFVRFSTKEAA 254
               |..  |:.||    ||...:||.:::.|..:|.|:.|.:..|      :|:.|:.::.:|..
Human   232 ---PKK--VFVGG----LSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPV 287

  Fly   255 THAI------VAVNNTEIN-QQPVKCAWGKESGDPNHMSAIAGGA-------------LAQGF-- 297
            ...:      :.....||. .||.:....::........|.|||.             ..|||  
Human   288 KKLLESRYHQIGSGKCEIKVAQPKEVYRQQQQQQKGGRGAAAGGRGGTRGRGRGQGQNWNQGFNN 352

  Fly   298 ----PFGSAAAAAAAAAYG--QQVAGYWYPPAPTYPAAAPASALQPGQFLQGMQGFTYGQFAGYQ 356
                .:|:     ..:|||  |..:||                   |.:  ...|:.||.: ||.
Human   353 YYDQGYGN-----YNSAYGGDQNYSGY-------------------GGY--DYTGYNYGNY-GYG 390

  Fly   357 Q--AGYMG 362
            |  |.|.|
Human   391 QGYADYSG 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34354NP_001097953.2 RRM2_TIA1_like 97..171 CDD:240799 22/73 (30%)
RRM3_TIA1_like 202..278 CDD:240800 19/88 (22%)
HNRNPDLNP_112740.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..83 4/16 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 96..120 9/23 (39%)
RRM1_hnRPDL 149..224 CDD:410152 23/90 (26%)
RRM2_hnRPDL 234..308 CDD:409998 17/79 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 313..348 4/34 (12%)
Necessary for interaction with TNPO1. /evidence=ECO:0000269|PubMed:9524220 342..420 20/84 (24%)
Necessary for its nuclear import and export 396..420 2/3 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 398..420 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.