DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34354 and SRSF9

DIOPT Version :9

Sequence 1:NP_001097953.2 Gene:CG34354 / 5740528 FlyBaseID:FBgn0085383 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_003760.1 Gene:SRSF9 / 8683 HGNCID:10791 Length:221 Species:Homo sapiens


Alignment Length:246 Identity:47/246 - (19%)
Similarity:90/246 - (36%) Gaps:57/246 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 IFVGDLSAEIETQQLKDAFTPFGEISDCRVVRDPQTLKSK----GYGFVSFVKKSEAETAITAMN 158
            |:||:|..::..:.|:|.|..:|.|.:..       ||::    .:.||.|....:||.||...|
Human    16 IYVGNLPTDVREKDLEDLFYKYGRIREIE-------LKNRHGLVPFAFVRFEDPRDAEDAIYGRN 73

  Fly   159 GQWLGSRSIRTNWATRKPPATKADMNAKPLTFDEVYNQSSPTNCTVYCGGINGALSGFLNEEILQ 223
            |...|...:|..:     |.|.......|.                  ||.||..:...:..:|.
Human    74 GYDYGQCRLRVEF
-----PRTYGGRGGWPR------------------GGRNGPPTRRSDFRVLV 115

  Fly   224 KTFSPYGTIQEIR-------------VFKDKGYAFVRFSTKEAATHAIVAVNNTEINQQPVKCAW 275
            ....|.|:.|:::             |.|| |...|.:..||...:|:..:::|:..        
Human   116 SGLPPSGSWQDLKDHMREAGDVCYADVQKD-GVGMVEYLRKEDMEYALRKLDDTKFR-------- 171

  Fly   276 GKESGDPNHMSAIAGGALAQGFPFGSAAAAAAAAAYGQQVAGYWYPPAPTY 326
             ...|:.:::......:.:.|:....:.:....:.|..:.:.:::.|...|
Human   172 -SHEGETSYIRVYPERSTSYGYSRSRSGSRGRDSPYQSRGSPHYFSPFRPY 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34354NP_001097953.2 RRM2_TIA1_like 97..171 CDD:240799 22/76 (29%)
RRM3_TIA1_like 202..278 CDD:240800 17/88 (19%)
SRSF9NP_003760.1 RRM1_SRSF9 15..86 CDD:241042 22/76 (29%)
RRM2_SRSF9 104..186 CDD:410161 14/91 (15%)
Interaction with SAFB1 188..200 1/11 (9%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 189..221 3/31 (10%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.