DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34354 and AT3G09160

DIOPT Version :9

Sequence 1:NP_001097953.2 Gene:CG34354 / 5740528 FlyBaseID:FBgn0085383 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_187528.2 Gene:AT3G09160 / 820071 AraportID:AT3G09160 Length:132 Species:Arabidopsis thaliana


Alignment Length:103 Identity:28/103 - (27%)
Similarity:42/103 - (40%) Gaps:27/103 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 DLSAEIETQQLKDAFTPFGEISDCRVVRDPQTLKSK--GYGFVSFVKKSEAETAITAMNGQWLGS 164
            :|..|....:||..|:|.|||:|..:   |:|..|.  .:.|:.||.:..|:.|: .:||..:| 
plant    33 ELPREHVESELKKLFSPCGEITDVHI---PETRNSSLWSHAFIYFVGEGTADKAL-QLNGSDMG- 92

  Fly   165 RSIRTNWATRKPPATKADMNAKPLTFDEVYNQSSPTNC 202
                 .|.        .|..|.|...:|       .||
plant    93 -----G
WT--------VDAEADPFPKEE-------DNC 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34354NP_001097953.2 RRM2_TIA1_like 97..171 CDD:240799 21/70 (30%)
RRM3_TIA1_like 202..278 CDD:240800 1/1 (100%)
AT3G09160NP_187528.2 RRM_SF 25..93 CDD:302621 21/69 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1066369at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.