DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34354 and hnrnpa3

DIOPT Version :9

Sequence 1:NP_001097953.2 Gene:CG34354 / 5740528 FlyBaseID:FBgn0085383 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_001315077.1 Gene:hnrnpa3 / 751729 ZFINID:ZDB-GENE-060224-1 Length:340 Species:Danio rerio


Alignment Length:306 Identity:74/306 - (24%)
Similarity:114/306 - (37%) Gaps:70/306 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 NNSKPEQFH-IFVGDLSAEIETQQLKDAFTPFGEISDCRVVRDPQTLKSKGYGFVSFVKKSEAET 152
            ::.:|||.. :|:|.||.|.....|:..|..:|:::||.|:|||...:|:|:|||::...||.:.
Zfish     5 DSKEPEQLRKLFIGGLSFETTEDSLRAHFEQWGKLTDCVVMRDPANKRSRGFGFVTYSSVSEVDA 69

  Fly   153 AITAMNGQWLGSRSIRTNWATRKPPATK--ADMNAKPLTFDEVYNQSSPTNCTVYCGGINGALSG 215
            |:||...: :..|.:....|..:..:.|  |.:..|                .::.|||...   
Zfish    70 AMTARPHK-VDGRVVEPKRAVSREDSNKPGAHLTVK----------------KIFVGGIKED--- 114

  Fly   216 FLNEEILQKTFSPYGTIQEIRVF------KDKGYAFVRFSTKEAATHAIVAVNNTEINQQ--PVK 272
             ..|..:::.|..||.|:.|.:.      |.:|:.||.|...: ....|||.....||..  .|:
Zfish   115 -TEEYHIREYFECYGKIETIDIMEERSTGKKRGFCFVTFDDHD-TVDKIVAQKYHTINSHNCEVR 177

  Fly   273 CAWGKE----SGDPNHMSAIAGGALAQGFPFGSAAAAAAAAA----------YGQQVAGY----- 318
            .|..|:    |.:..:.....|....:|..||..........          ||....||     
Zfish   178 KALPKQEMQSSSNQRYRGGGGGNFTGRGGNFGRGGYGGGRGGGDGYNGFGGNYGGGPGGYGGGRG 242

  Fly   319 WYPPAPTYPAAAPASALQPGQFLQGMQ--GFTYGQFAGYQQAGYMG 362
            .|...|.|                |.|  |..:|.|..|...|..|
Zfish   243 GYGGGPGY----------------GNQGGGGGFGGFDNYNDRGNFG 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34354NP_001097953.2 RRM2_TIA1_like 97..171 CDD:240799 25/74 (34%)
RRM3_TIA1_like 202..278 CDD:240800 21/83 (25%)
hnrnpa3NP_001315077.1 RRM1_hnRNPA_like 14..91 CDD:241022 26/77 (34%)
RRM2_hnRNPA3 104..183 CDD:241026 22/99 (22%)
HnRNPA1 <296..>315 CDD:288479
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.