DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34354 and EIF4H

DIOPT Version :10

Sequence 1:NP_001097953.2 Gene:CG34354 / 5740528 FlyBaseID:FBgn0085383 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_071496.1 Gene:EIF4H / 7458 HGNCID:12741 Length:248 Species:Homo sapiens


Alignment Length:86 Identity:29/86 - (33%)
Similarity:40/86 - (46%) Gaps:15/86 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 VGNNSKPEQFHIFVGDLSAEIETQQLKDAFTPFGEISDCRVVRDPQTLKSKGYGFVSFVKKSEAE 151
            |||    ..|:...||:.|     ..||.     .|...|:|||..|.|.||:.:|.|.:....:
Human    46 VGN----LPFNTVQGDIDA-----IFKDL-----SIRSVRLVRDKDTDKFKGFCYVEFDEVDSLK 96

  Fly   152 TAITAMNGQWLGSRSIRTNWA 172
            .|:| .:|..||.||:|.:.|
Human    97 EALT-YDGALLGDRSLRVDIA 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34354NP_001097953.2 PABP-1234 <90..420 CDD:130689 26/83 (31%)
RRM2_TIA1_like 97..171 CDD:409789 24/73 (33%)
RRM3_TIA1_like 202..276 CDD:409790
EIF4HNP_071496.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41
RRM_eIF4H 37..120 CDD:409835 29/86 (34%)
SF-CC1 <40..>227 CDD:273721 29/86 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 121..248
HHV-1 Vhs binding site 137..157
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.