DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34354 and TIA1

DIOPT Version :9

Sequence 1:NP_001097953.2 Gene:CG34354 / 5740528 FlyBaseID:FBgn0085383 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_071505.2 Gene:TIA1 / 7072 HGNCID:11802 Length:386 Species:Homo sapiens


Alignment Length:396 Identity:167/396 - (42%)
Similarity:208/396 - (52%) Gaps:93/396 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 AAAAAAQQQQQSVTAAHLQHNGQQQHSQQQQQQQMSQQQQQQQQQLVGNNSKPEQFHIFVGDLSA 105
            ||||.|....:.:....::.|.....|.|::....|.....|:.|        :.||:||||||.
Human    59 AAAALAAMNGRKIMGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQ--------DHFHVFVGDLSP 115

  Fly   106 EIETQQLKDAFTPFGEISDCRVVRDPQTLKSKGYGFVSFVKKSEAETAITAMNGQWLGSRSIRTN 170
            ||.|:.:|.||.|||.|||.|||:|..|.||||||||||..|.:||.||..|.|||||.|.||||
Human   116 EITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTN 180

  Fly   171 WATRKPPATKA--DMNAKPLTFDEVYNQSSPTNCTVYCGGINGALSGFLNEEILQKTFSPYGTIQ 233
            ||||||||.|:  :.|.|.|::|||.|||||:||||||||:...|:    |:::::||||:|.|.
Human   181 WATRKPPAPKSTYESNTKQLSYDEVVNQSSPSNCTVYCGGVTSGLT----EQLMRQTFSPFGQIM 241

  Fly   234 EIRVFKDKGYAFVRFSTKEAATHAIVAVNNTEINQQPVKCAWGKESGD-------PNHMSAIAGG 291
            |||||.||||:||||::.|:|.||||:||.|.|....|||.||||:.|       .|.:      
Human   242 EIRVFPDKGYSFVRFNSHESAAHAIVSVNGTTIEGHVVKCYWGKETLDMINPVQQQNQI------ 300

  Fly   292 ALAQGFPFGSAAAAAAAAAYGQQVAGYWYPPAPTYPAAAPASALQPGQFL-QGMQGFTYGQFA-- 353
                |:|          ..|||.  |.||           .:|.|.||:: .|.|...||.:.  
Human   301 ----GYP----------QPYGQW--GQWY-----------GNAQQIGQYMPNGWQVPAYGMYGQA 338

  Fly   354 ----GYQQ----AGYMG--MGVQLPGTWQSVPPQPQLASAAAATAPQITQSVGSALP-QAAG--V 405
                |:.|    |.:||  .|||        |||.|               .||.|| |.:|  |
Human   339 WNQQGFNQTQSSAPWMGPNYGVQ--------PPQGQ---------------NGSMLPNQPSGYRV 380

  Fly   406 VAYPMQ 411
            ..|..|
Human   381 AGYETQ 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34354NP_001097953.2 RRM2_TIA1_like 97..171 CDD:240799 49/73 (67%)
RRM3_TIA1_like 202..278 CDD:240800 43/75 (57%)
TIA1NP_071505.2 RRM1_TIA1 8..81 CDD:410027 6/21 (29%)
RRM2_TIA1 104..181 CDD:410030 50/76 (66%)
RRM3_TIAR 214..286 CDD:241064 43/75 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 354..386 17/54 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 99 1.000 Domainoid score I7073
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1066369at2759
OrthoFinder 1 1.000 - - FOG0000924
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10352
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X831
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
77.020

Return to query results.
Submit another query.