DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34354 and Cstf2

DIOPT Version :9

Sequence 1:NP_001097953.2 Gene:CG34354 / 5740528 FlyBaseID:FBgn0085383 Length:550 Species:Drosophila melanogaster
Sequence 2:XP_038955991.1 Gene:Cstf2 / 683927 RGDID:1596566 Length:624 Species:Rattus norvegicus


Alignment Length:393 Identity:105/393 - (26%)
Similarity:151/393 - (38%) Gaps:93/393 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 IFVGDLSAEIETQQLKDAFTPFGEISDCRVVRDPQTLKSKGYGFVSFVKKSEAETAITAM---NG 159
            :|||::..|...:||||.|:..|.:...|:|.|.:|.|.|||||..:   .:.|||::||   ||
  Rat    18 VFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEY---QDQETALSAMRNLNG 79

  Fly   160 QWLGSRSIRT-NWATRKPPATKADMNAKPLTFDEVYNQS-SPTNCTVYCGGINGALSGFLNEEIL 222
            :....|::|. |.|:.|.......:.......:..|.:| ||.:..   ..|:.|::....|::.
  Rat    80 REFSGRALRVDNAAS
EKNKEELKSLGTGAPVIESPYGESISPEDAP---ESISKAVASLPPEQMF 141

  Fly   223 ----QKTFSPYGTIQEIR--VFKDKGYAF--------VRFSTKEAATHAIVAVNNTEI----NQQ 269
                |.......:.||.|  :.::...|:        :|....|.|...:....|...    |.|
  Rat   142 ELMKQMKLCVQNSPQEARNMLLQNPQLAYALLQAQVVMRIVDPEIALKILHRQTNIPTLISGNPQ 206

  Fly   270 PVKCAWGKESGDPN-----------HMSAIAG----GA---LAQGFPFGSAAAAAAAAAYGQQVA 316
            ||..| |..|| ||           ...:::|    ||   :....|.|..|....|||    ||
  Rat   207 PVHVA-GPGSG-PNVSMNQQNPQAPQAQSLSGMHVNGAPPMMQASMPGGVPAPVQMAAA----VA 265

  Fly   317 GYWYPPAPTYPAAAPASALQPGQFLQGMQGFTYGQFAGYQQAGYMGMGVQLPGTWQSVPPQPQLA 381
            |    |.|  .:.|||..:|.   ..||||           ||.:.| .:..||.|..|..|  |
  Rat   266 G----PGP--GSLAPAGVMQA---QVGMQG-----------AGPVPM-ERGQGTLQHSPVGP--A 307

  Fly   382 SAAAATAPQ------ITQSVGSALPQAA------GVVAYPMQQFQVSPQLAEDEWLAPSLLVXLP 434
            ..|:....|      |..||..:.|...      |:...|||    .|:.|......|: .| .|
  Rat   308 GPASIERVQGQRTWMIWASVRGSTPSLLVSGGLDGIAVLPMQ----DPRAAMQRGALPA-NVPTP 367

  Fly   435 XGM 437
             |:
  Rat   368 RGL 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34354NP_001097953.2 RRM2_TIA1_like 97..171 CDD:240799 29/76 (38%)
RRM3_TIA1_like 202..278 CDD:240800 18/93 (19%)
Cstf2XP_038955991.1 RRM_CSTF2_CSTF2T 10..94 CDD:410072 30/78 (38%)
CSTF2_hinge 112..191 CDD:405077 15/81 (19%)
PRK14718 <444..>501 CDD:173181
CSTF_C 580..620 CDD:405061
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.