powered by:
Protein Alignment CG34354 and cirbpb
DIOPT Version :9
Sequence 1: | NP_001097953.2 |
Gene: | CG34354 / 5740528 |
FlyBaseID: | FBgn0085383 |
Length: | 550 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001035411.2 |
Gene: | cirbpb / 678563 |
ZFINID: | ZDB-GENE-030131-5841 |
Length: | 206 |
Species: | Danio rerio |
Alignment Length: | 75 |
Identity: | 30/75 - (40%) |
Similarity: | 50/75 - (66%) |
Gaps: | 0/75 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 98 IFVGDLSAEIETQQLKDAFTPFGEISDCRVVRDPQTLKSKGYGFVSFVKKSEAETAITAMNGQWL 162
:|:|.||.:...|.|::||:.:|.|:...|:||.:|.:|:|:|||:|....:|:.|:.||||:.:
Zfish 7 LFIGGLSYDTTEQSLEEAFSKYGTIAKVDVIRDRETDRSRGFGFVTFENPEDAKDAMAAMNGKQV 71
Fly 163 GSRSIRTNWA 172
..|.||.:.|
Zfish 72 DGRMIRVDEA 81
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.