DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34354 and TRA2B

DIOPT Version :10

Sequence 1:NP_001097953.2 Gene:CG34354 / 5740528 FlyBaseID:FBgn0085383 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_004584.1 Gene:TRA2B / 6434 HGNCID:10781 Length:288 Species:Homo sapiens


Alignment Length:132 Identity:34/132 - (25%)
Similarity:65/132 - (49%) Gaps:1/132 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 QQQSVTAAHLQHNGQQQHSQQQQQQQMSQQQQQQQQQLVGNNSKPE-QFHIFVGDLSAEIETQQL 112
            :.:|.:.:|.:...:......:::...|......:::.|||.:.|: ...:.|..||.....:.|
Human    70 RSRSRSRSHRRSRSRSYSRDYRRRHSHSHSPMSTRRRHVGNRANPDPNCCLGVFGLSLYTTERDL 134

  Fly   113 KDAFTPFGEISDCRVVRDPQTLKSKGYGFVSFVKKSEAETAITAMNGQWLGSRSIRTNWATRKPP 177
            ::.|:.:|.|:|..:|.|.|:.:|:|:.||.|....:|:.|....||..|..|.||.:::..|.|
Human   135 REVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRP 199

  Fly   178 AT 179
            .|
Human   200 HT 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34354NP_001097953.2 PABP-1234 <90..420 CDD:130689 28/91 (31%)
RRM2_TIA1_like 97..171 CDD:409789 24/73 (33%)
RRM3_TIA1_like 202..276 CDD:409790
TRA2BNP_004584.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..114 6/43 (14%)
RRM_TRA2 117..196 CDD:409798 24/78 (31%)
Linker 193..230 3/9 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 196..225 3/6 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..288
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.