Sequence 1: | NP_001097953.2 | Gene: | CG34354 / 5740528 | FlyBaseID: | FBgn0085383 | Length: | 550 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_005617.2 | Gene: | SRSF4 / 6429 | HGNCID: | 10786 | Length: | 494 | Species: | Homo sapiens |
Alignment Length: | 203 | Identity: | 41/203 - (20%) |
---|---|---|---|
Similarity: | 80/203 - (39%) | Gaps: | 63/203 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 98 IFVGDLSAEIETQQLKDAFTPFGEISDCRVVRDPQTLKSKGYGFVSFVKKSEAETAITAMNGQWL 162
Fly 163 -GSRSI----------------RTNWATRKP------PATKADMNAKPLTFDEVYNQSSPTNCTV 204
Fly 205 Y---CGGIN--GALSGFLNEEILQKTFSPYGTIQEIRVFKDKGYAFVRFSTKEAATHAIVAVNNT 264
Fly 265 EINQQPVK 272 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG34354 | NP_001097953.2 | RRM2_TIA1_like | 97..171 | CDD:240799 | 23/89 (26%) |
RRM3_TIA1_like | 202..278 | CDD:240800 | 13/76 (17%) | ||
SRSF4 | NP_005617.2 | RRM1_SRSF4_like | 3..72 | CDD:240783 | 22/75 (29%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 72..95 | 2/22 (9%) | |||
RRM2_SRSF4_like | 104..175 | CDD:241044 | 15/95 (16%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 169..494 | 0/3 (0%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |