DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34354 and SRSF4

DIOPT Version :9

Sequence 1:NP_001097953.2 Gene:CG34354 / 5740528 FlyBaseID:FBgn0085383 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_005617.2 Gene:SRSF4 / 6429 HGNCID:10786 Length:494 Species:Homo sapiens


Alignment Length:203 Identity:41/203 - (20%)
Similarity:80/203 - (39%) Gaps:63/203 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 IFVGDLSAEIETQQLKDAFTPFGEISDCRVVRDPQTLKSKGYGFVSFVKKSEAETAITAMNGQWL 162
            :::|.||.:...:.::..|..:|:|.:.       .||: |||||.|....:|:.|:..:||:.|
Human     4 VYIGRLSYQARERDVERFFKGYGKILEV-------DLKN-GYGFVEFDDLRDADDAVYELNGKDL 60

  Fly   163 -GSRSI----------------RTNWATRKP------PATKADMNAKPLTFDEVYNQSSPTNCTV 204
             |.|.|                |:.:..|:.      |.|:.:..   |..:.:.::.|..:...
Human    61 CGERVIVEHARGPRRDGSYGSGRSGYGYRRSGRDK
YGPPTRTEYR---LIVENLSSRCSWQDLKD 122

  Fly   205 Y---CGGIN--GALSGFLNEEILQKTFSPYGTIQEIRVFKDKGYAFVRFSTKEAATHAIVAVNNT 264
            |   .|.:.  .|..|..||.:::                     ||.:|..:   .|:..::.|
Human   123 YMRQAGEVTYADAHKGRKNEGVIE---------------------FVSYSDMK---RALEKLDGT 163

  Fly   265 EINQQPVK 272
            |:|.:.::
Human   164 EVNGRKIR 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34354NP_001097953.2 RRM2_TIA1_like 97..171 CDD:240799 23/89 (26%)
RRM3_TIA1_like 202..278 CDD:240800 13/76 (17%)
SRSF4NP_005617.2 RRM1_SRSF4_like 3..72 CDD:240783 22/75 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 72..95 2/22 (9%)
RRM2_SRSF4_like 104..175 CDD:241044 15/95 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 169..494 0/3 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.