DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34354 and RBM3

DIOPT Version :10

Sequence 1:NP_001097953.2 Gene:CG34354 / 5740528 FlyBaseID:FBgn0085383 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_006734.1 Gene:RBM3 / 5935 HGNCID:9900 Length:157 Species:Homo sapiens


Alignment Length:87 Identity:34/87 - (39%)
Similarity:53/87 - (60%) Gaps:0/87 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 EQFHIFVGDLSAEIETQQLKDAFTPFGEISDCRVVRDPQTLKSKGYGFVSFVKKSEAETAITAMN 158
            |:..:|||.|:...:.|.|:|.|:.||.||:..||:|.:|.:|:|:||::|.....|..|:.|||
Human     4 EEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMN 68

  Fly   159 GQWLGSRSIRTNWATRKPPATK 180
            |:.|..|.||.:.|.:....|:
Human    69 GESLDGRQIRVDHAGKSARGTR 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34354NP_001097953.2 PABP-1234 <90..420 CDD:130689 34/87 (39%)
RRM2_TIA1_like 97..171 CDD:409789 31/73 (42%)
RRM3_TIA1_like 202..276 CDD:409790
RBM3NP_006734.1 RRM_CIRBP_RBM3 6..85 CDD:409883 32/78 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..157 2/10 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.