DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34354 and Srsf4

DIOPT Version :9

Sequence 1:NP_001097953.2 Gene:CG34354 / 5740528 FlyBaseID:FBgn0085383 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_001356237.1 Gene:Srsf4 / 57317 MGIID:1890577 Length:496 Species:Mus musculus


Alignment Length:76 Identity:21/76 - (27%)
Similarity:35/76 - (46%) Gaps:9/76 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 QFHIFVGDLSAEIETQQLKDAFTPFGEI--SDCRVVRDPQTLKSKGYGFVSFVKKSEAETAITAM 157
            ::.:.|.:||:....|.|||.....||:  :|....|       |..|.:.||..|:.:.|:..:
Mouse   108 EYRLIVENLSSRCSWQDLKDYMRQAGEVTYADAHKGR-------KNEGVIEFVSYSDMKRALEKL 165

  Fly   158 NGQWLGSRSIR 168
            :|..:..|.||
Mouse   166 DGTEVNGRKIR 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34354NP_001097953.2 RRM2_TIA1_like 97..171 CDD:240799 21/74 (28%)
RRM3_TIA1_like 202..278 CDD:240800
Srsf4NP_001356237.1 RRM_SF <42..77 CDD:388407
RRM2_SRSF4_like 109..180 CDD:241044 21/75 (28%)
U2AF_lg 250..>361 CDD:273727
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.