DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34354 and eif4ba

DIOPT Version :10

Sequence 1:NP_001097953.2 Gene:CG34354 / 5740528 FlyBaseID:FBgn0085383 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_001092707.3 Gene:eif4ba / 553214 ZFINID:ZDB-GENE-060629-1 Length:616 Species:Danio rerio


Alignment Length:115 Identity:28/115 - (24%)
Similarity:49/115 - (42%) Gaps:30/115 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 FVGDLSAEIETQQLKDAFTPFGEISDCRVVRDPQT-LKSKGYGFVSFVKKSEAETAITA--MNGQ 160
            |:|:|..::....:|:.|... .||..|:.|:|.. .:.||:|:..|   .:.|:.:.|  :|.:
Zfish    99 FLGNLPYDVTEDSIKNFFRGL-SISAVRLPREPSNPERLKGFGYAEF---DDVESLLQALSLNEE 159

  Fly   161 WLGSRSIRTNWATRK-----------------------PPATKADMNAKP 187
            .||:|.||.:.|.:.                       |..|.:|..|:|
Zfish   160 NLGNRRIRVDIADQSNEKERDDRSVSGRDRNRSDRDMGPDKTDSDWRARP 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34354NP_001097953.2 PABP-1234 <90..420 CDD:130689 28/115 (24%)
RRM2_TIA1_like 97..171 CDD:409789 22/74 (30%)
RRM3_TIA1_like 202..276 CDD:409790
eif4baNP_001092707.3 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.