DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34354 and Hnrnpa2b1

DIOPT Version :9

Sequence 1:NP_001097953.2 Gene:CG34354 / 5740528 FlyBaseID:FBgn0085383 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_001361674.1 Gene:Hnrnpa2b1 / 53379 MGIID:104819 Length:353 Species:Mus musculus


Alignment Length:282 Identity:68/282 - (24%)
Similarity:109/282 - (38%) Gaps:62/282 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 EQFH-IFVGDLSAEIETQQLKDAFTPFGEISDCRVVRDPQTLKSKGYGFVSFVKKSEAETAITAM 157
            |||. :|:|.||.|...:.|::.:..:|:::||.|:|||.:.:|:|:|||:|...:|.:.|:.| 
Mouse    18 EQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAA- 81

  Fly   158 NGQWLGSRSIRTNWATRKPPATK--ADMNAKPLTFDEVYNQSSPTNCTVYCGGINGALSGFLNEE 220
            ....:..|.:....|..:..:.|  |.:..|.|                :.|||...    ..|.
Mouse    82 RPHSIDGRVVEPKRAVAREESGKPGAHVTVKKL----------------FVGGIKED----TEEH 126

  Fly   221 ILQKTFSPYGTIQEIRVFKD------KGYAFVRFSTKEAATHAIVAVNNTEIN--QQPVKCAWGK 277
            .|:..|..||.|..|.:..|      :|:.||.|...:.....::...:| ||  ...|:.|..:
Mouse   127 HLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHT-INGHNAEVRKALSR 190

  Fly   278 ESGDPNHMSAIAGGALAQGFPFGSAAAAAAAAAYGQQVAGYWYPPAPTYPAAAPASALQPGQFLQ 342
            :     .|..:......:|..||...:......:|         |.|            ...|..
Mouse   191 Q-----EMQEVQSSRSGRGGNFGFGDSRGGGGNFG---------PGP------------GSNFRG 229

  Fly   343 GMQGFTYGQFAGYQQAGYMGMG 364
            |..|  ||...|:.. ||.|.|
Mouse   230 GSDG--YGSGRGFGD-GYNGYG 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34354NP_001097953.2 RRM2_TIA1_like 97..171 CDD:240799 23/74 (31%)
RRM3_TIA1_like 202..278 CDD:240800 20/83 (24%)
Hnrnpa2b1NP_001361674.1 Nuclear localization signal. /evidence=ECO:0000255 9..15
RRM1_hnRNPA2B1 19..99 CDD:410155 26/80 (33%)
RRM2_hnRNPA2B1 112..191 CDD:409995 22/99 (22%)
Disordered. /evidence=ECO:0000250|UniProtKB:P22626 193..353 17/80 (21%)
HnRNPA1 302..326 CDD:402981
Nuclear targeting sequence. /evidence=ECO:0000250 308..347
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.