DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34354 and Hrb87F

DIOPT Version :9

Sequence 1:NP_001097953.2 Gene:CG34354 / 5740528 FlyBaseID:FBgn0085383 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster


Alignment Length:298 Identity:70/298 - (23%)
Similarity:110/298 - (36%) Gaps:52/298 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 SKPEQFH-IFVGDLSAEIETQQLKDAFTPFGEISDCRVVRDPQTLKSKGYGFVSFVKKSEAETAI 154
            ::|||.. :|:|.|........||..|..:|.|.|..|::||:|.:|:|:||:::.:....:.|.
  Fly    18 TEPEQLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQ 82

  Fly   155 TAMNGQWLGSRSIRTNWATRKPPATKADMNAKPLTFDEVYNQSSPTNCTVYCGGINGALSGFLNE 219
            .|...:..|    ||....|..|..:.|......|..:::               .|.|....:|
  Fly    83 NARPHKIDG----RTVEPKRAVPRQEIDSPNAGATVKKLF---------------VGGLRDDHDE 128

  Fly   220 EILQKTFSPYGTIQEIRVFKDK------GYAFVRFSTKEAATHAIV----AVNNTEINQQPVKCA 274
            |.|::.|..:|.|..:.:..||      |:||:.|...:.....|:    ::.|..::   ||.|
  Fly   129 ECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSIKNKTLD---VKKA 190

  Fly   275 WGKESGDPNHMSAIAGGALAQGFPFGSAAAAAAAAAYG----QQVAGYWYPPAPTYPAAAPASAL 335
            ..|:..|........||..|.| ..|..........:|    |...|.|            ..|.
  Fly   191 IAKQDMDRQGGGGGRGGPRAGG-RGGQGDRGQGGGGWGGQNRQNGGGNW------------GGAG 242

  Fly   336 QPGQFLQGMQGFTYGQFAGYQQAGYMGMGVQLPGTWQS 373
            ..|.|  |..|..:|...|....|:...|....|.|.:
  Fly   243 GGGGF--GNSGGNFGGGQGGGSGGWNQQGGSGGGPWNN 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34354NP_001097953.2 RRM2_TIA1_like 97..171 CDD:240799 22/74 (30%)
RRM3_TIA1_like 202..278 CDD:240800 19/85 (22%)
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 23/80 (29%)
RRM_SF 116..188 CDD:302621 16/89 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463969
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.