DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34354 and Rox8

DIOPT Version :9

Sequence 1:NP_001097953.2 Gene:CG34354 / 5740528 FlyBaseID:FBgn0085383 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_001262897.1 Gene:Rox8 / 42848 FlyBaseID:FBgn0005649 Length:470 Species:Drosophila melanogaster


Alignment Length:410 Identity:176/410 - (42%)
Similarity:213/410 - (51%) Gaps:106/410 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 GNNSKPE---QFHIFVGDLSAEIETQQLKDAFTPFGEISDCRVVRDPQTLKSKGYGFVSFVKKSE 149
            ||..|.:   ..||||||||.||||:.|::||.||||||:||:||||.|:|||||.|||||||:|
  Fly    84 GNQPKTDISSHHHIFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAE 148

  Fly   150 AETAITAMNGQWLGSRSIRTNWATRKPPATK---------ADMNAKP-----------LTFDEVY 194
            ||.||.||||||:|||||||||:|||.|..:         ..|...|           .||:|||
  Fly   149 AENAIQAMNGQWIGSRSIRTNWSTRKLPPPREPSKGGGQGGGMGGGPGNGSGVKGSQRHTFEEVY 213

  Fly   195 NQSSPTNCTVYCGGINGALSGFLNEEILQKTFSPYGTIQEIRVFKDKGYAFVRFSTKEAATHAIV 259
            |||||||.||||||..   ...::::::.|.|..:|.||::|||||||::|::|.|||||.|||.
  Fly   214 NQSSPTNTTVYCGGFP---PNVISDDLMHKHFVQFGPIQDVRVFKDKGFSFIKFVTKEAAAHAIE 275

  Fly   260 AVNNTEINQQPVKCAWGKESG---DPNHMSAIAGGALAQGFPFGSAAAAAAAAA----------- 310
            ..:|:|::...|||.||||:|   ..|:::|.|..|.|.......|||.||.||           
  Fly   276 HTHNSEVHGNLVKCFWGKENGGDNSANNLNAAAAAAAASANVAAVAAANAAVAAGAGMPGQMMTQ 340

  Fly   311 --------------------------YGQQVAGYWYPPA--PT------------YPAAAPASAL 335
                                      |..|..|||||||  ||            ||.|.|.||.
  Fly   341 QQIAAATGAAIPGQMMTPQQIAAQYPYAYQQMGYWYPPATYPTTQMQTQYMQQGYYPYAYPTSAQ 405

  Fly   336 QPGQFLQGMQGFTYGQFAGYQQAGY------MGMGVQLPGTWQSVPPQPQLASAAAATAPQITQS 394
            |.|       |....||:.   |||      :..||  |||   |.|....|:|:||.|..    
  Fly   406 QAG-------GVPCIQFSA---AGYRMVPPNVAWGV--PGT---VVPGVTAAAASAAAAAN---- 451

  Fly   395 VGSALPQAAGVVAYPMQQFQ 414
             ||..||.....|.|..|.|
  Fly   452 -GSLAPQMMYSAAMPQYQTQ 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34354NP_001097953.2 RRM2_TIA1_like 97..171 CDD:240799 58/73 (79%)
RRM3_TIA1_like 202..278 CDD:240800 35/75 (47%)
Rox8NP_001262897.1 ELAV_HUD_SF 5..274 CDD:273741 107/192 (56%)
RRM1_TIA1_like 9..80 CDD:240798
RRM2_TIA1_like 96..170 CDD:240799 58/73 (79%)
RRM3_TIA1_like 221..294 CDD:240800 35/75 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 77 1.000 Domainoid score I3083
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 189 1.000 Inparanoid score I1394
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100171at50557
OrthoFinder 1 1.000 - - FOG0000924
OrthoInspector 1 1.000 - - mtm1150
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10352
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X831
88.070

Return to query results.
Submit another query.