DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34354 and Rbp4

DIOPT Version :9

Sequence 1:NP_001097953.2 Gene:CG34354 / 5740528 FlyBaseID:FBgn0085383 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster


Alignment Length:347 Identity:75/347 - (21%)
Similarity:120/347 - (34%) Gaps:104/347 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 IFVGDLSAEIETQQLKDAFTPFGEISDCRVVRDPQTLKSKGYGFVSFVKKSEAETAITAMNGQWL 162
            ||:|.||.:...:.|:..|:.||.::|..|:|||.:..|:|:|||::|                 
  Fly    34 IFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYV----------------- 81

  Fly   163 GSRSIRTNWATRKPPATKADMNAKPLTFDEVYNQSS---PTNCTVYCGGIN------GALSGFLN 218
                        .|.:.:....|:|.|.|....::.   |.......||:.      |..:||:|
  Fly    82 ------------DPKSVEIVQRARPHTIDNKIVETKHALPR
QDFKRGGGVGSVVGSFGCEAGFMN 134

  Fly   219 --------------EEILQKTFSPYGTIQEIRVFKD------KGYAFVRFSTKEAATHAIVAVNN 263
                          |.|:::.||.:|.:..:::..|      :.:.|:.|....:|..|: |...
  Fly   135 SKRIFLGGLKEYHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKAL-APRK 198

  Fly   264 TEINQQPVKCAWGKESGDPNHMSAIAGGALAQGFPFGSAAAAAAAAAYGQQVAGYWYP-PA---- 323
            ..|.|..|:.....:..|....           ||..|:..           |||..| ||    
  Fly   199 HWILQTLVEVKRSTQKADRRFR-----------FPIFSSVR-----------AGYIPPQPATADS 241

  Fly   324 -----PTYPAAAPASALQPGQFLQGMQGF--------TYGQFAG----YQQAGYMGMGVQLPGTW 371
                 |.|......|.|.|..|..|...:        |.||...    .||.....:....|..|
  Fly   242 YNYNNPNYNPYLAQSVLPPSAFTNGWAHYVIPMAPKPTPGQNMAASLPSQQLAEHSLNGHGPDMW 306

  Fly   372 QSVPPQPQLASAAAATAPQITQ 393
            .|. |:..:.||...|:.::.:
  Fly   307 SSY-PKTGIYSAQEWTSSKVAE 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34354NP_001097953.2 RRM2_TIA1_like 97..171 CDD:240799 20/72 (28%)
RRM3_TIA1_like 202..278 CDD:240800 20/101 (20%)
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 25/104 (24%)
RRM2_hnRNPA_like 137..209 CDD:240774 14/72 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464028
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.