DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34354 and sqd

DIOPT Version :9

Sequence 1:NP_001097953.2 Gene:CG34354 / 5740528 FlyBaseID:FBgn0085383 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster


Alignment Length:309 Identity:71/309 - (22%)
Similarity:116/309 - (37%) Gaps:79/309 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 QLVGNNSKPEQFHIFVGDLSAEIETQQLKDAFTPFGEISDCRVVRDPQTLKSKGYGFVSFVKKSE 149
            |...:..:.:...:|||.||.|...::|:|.|..:|||....|..||||.:|:|:.|:.|. .:|
  Fly    45 QSAASGQRDDDRKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFT-NTE 108

  Fly   150 AETAITAMNGQWLGSRSIRTNWATRKPPATKADMNAKPLTFDEVYNQSSPTNCTVYCGGINGALS 214
            |...::|.:...:.|:.:       .|...||                  .:..::.||:...:|
  Fly   109 AIDKVSAADEHIINSKKV-------DPKKAKA------------------RHGKIFVGGLTTEIS 148

  Fly   215 GFLNEEILQKT-FSPYGTIQEIRVFKD------KGYAFVRFSTKEAATHAI------VAVNNTEI 266
               :|||  || |..:|.|.|:.:..|      ||:.|:.|.:::..|..:      :|....::
  Fly   149 ---DEEI--KTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDV 208

  Fly   267 NQQPVK----CAWGKESGDPNHMSAIAGGALAQG------------FPFGSAAAAAAAAAYGQQV 315
            .:...|    ...|...|....|....||...:|            ..:|.......|..||...
  Fly   209 KRATPKPENQMMGGMRGGPRGGMRGGRGGYGGRGGYNNQWDGQGSYGGYGGGYGGYGAGGYGDYY 273

  Fly   316 AGYWYPPAPTYPAAAPASALQPGQFLQGMQGFTYGQFAGYQQAGYMGMG 364
            ||.:|                 ..:..|..|:.||  .|::..||.|.|
  Fly   274 AGGYY-----------------NGYDYGYDGYGYG--GGFEGNGYGGGG 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34354NP_001097953.2 RRM2_TIA1_like 97..171 CDD:240799 25/73 (34%)
RRM3_TIA1_like 202..278 CDD:240800 21/92 (23%)
sqdNP_731825.1 RRM_SF 58..129 CDD:302621 25/78 (32%)
RRM2_hnRNPD_like 137..211 CDD:240775 19/78 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464020
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.