DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34354 and CG4612

DIOPT Version :9

Sequence 1:NP_001097953.2 Gene:CG34354 / 5740528 FlyBaseID:FBgn0085383 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster


Alignment Length:279 Identity:63/279 - (22%)
Similarity:105/279 - (37%) Gaps:77/279 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 AAAQQQQQ----SVTAAHLQHNGQQQHSQQQQQQQMSQQQQQQQQQL------------------ 86
            |||..|||    :..|.||.|.| ..|:........:...:.....|                  
  Fly    28 AAAHHQQQLHHHAAAAGHLSHVG-GGHAASNHLAAAAVLGRHGHNSLGSGHTSTSSHSANVGVGV 91

  Fly    87 ------------VGNNSKPEQFHIFVGDLSAEIETQQLKDAFTPFGEISDCRVVRDPQTLKSKGY 139
                        .|.||.|:...|::.:|...|:.:.:.|.|:.||.|.:|.|.:| :...|:||
  Fly    92 GGGALASGSTGGSGGNSSPDSGKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKD-EDGNSRGY 155

  Fly   140 GFVSFVKKSEAETAITAMNGQWLGSRSIR-TNWATRKPPATKADMNAKPLT-FDEVYNQSSPTNC 202
            |||.|..:..|..||..:||....::.:. ..:..|:      |...:..| |..:|.::     
  Fly   156 GFVHFDSEEAARAAIEKVNGMLCNNQKVHVVKFIPRR------DREQEKATHFKNLYVKN----- 209

  Fly   203 TVYCGGINGALSGFLNEEILQKTFSPYGTIQEIRVFKD-----KGYAFVRFSTKEAATHAIVAVN 262
                      ||....|:.|::.|.|||.|...::..|     :.:.||.:...::|..|::.::
  Fly   210 ----------LSEEFTEQHLREMFEPYGRITSHKLMLDEEGRSRRFGFVAYENPQSALAAVIGLH 264

  Fly   263 NTEINQQPVKCAWGKESGD 281
                         ||:.||
  Fly   265 -------------GKQLGD 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34354NP_001097953.2 RRM2_TIA1_like 97..171 CDD:240799 23/74 (31%)
RRM3_TIA1_like 202..278 CDD:240800 15/80 (19%)
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 23/70 (33%)
RRM3_I_PABPs 202..282 CDD:240826 20/97 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.