DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG34354 and SLIRP1

DIOPT Version :9

Sequence 1:	NP_001097953.2	Gene:	CG34354 / 5740528	FlyBaseID:	FBgn0085383	Length:	550	Species:	Drosophila melanogaster
Sequence 2:	NP_001027083.1	Gene:	SLIRP1 / 3772560	FlyBaseID:	FBgn0064117	Length:	90	Species:	Drosophila melanogaster

Alignment Length:	60	Identity:	24/60 - (40%)
Similarity:	34/60 - (56%)	Gaps:	7/60 - (11%)

- Green bases have known domain annotations that are detailed below.

  Fly    98 IFVGDLSAEIETQQLKDAFTPFGEISDCRVVRDPQTLKSKGYGFVSFVKKSEAETAITAM 157
            ||||:|...:..|:|:..|..||.:....|:.|.:|..|||||||||       .::||:
  Fly    17 IFVGNLPWTVGHQELRGYFREFGRVVSANVIFDKRTGCSKGYGFVSF-------NSLTAL 69

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG34354	NP_001097953.2	RRM2_TIA1_like	97..171	CDD:240799	24/60 (40%)
CG34354	NP_001097953.2	RRM3_TIA1_like	202..278	CDD:240800
SLIRP1	NP_001027083.1	RRM_SLIRP	16..88	CDD:409688	24/60 (40%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C45464006
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	2	1.840