powered by:
Protein Alignment CG34354 and SLIRP1
DIOPT Version :9
Sequence 1: | NP_001097953.2 |
Gene: | CG34354 / 5740528 |
FlyBaseID: | FBgn0085383 |
Length: | 550 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001027083.1 |
Gene: | SLIRP1 / 3772560 |
FlyBaseID: | FBgn0064117 |
Length: | 90 |
Species: | Drosophila melanogaster |
Alignment Length: | 60 |
Identity: | 24/60 - (40%) |
Similarity: | 34/60 - (56%) |
Gaps: | 7/60 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 98 IFVGDLSAEIETQQLKDAFTPFGEISDCRVVRDPQTLKSKGYGFVSFVKKSEAETAITAM 157
||||:|...:..|:|:..|..||.:....|:.|.:|..||||||||| .::||:
Fly 17 IFVGNLPWTVGHQELRGYFREFGRVVSANVIFDKRTGCSKGYGFVSF-------NSLTAL 69
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45464006 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.840 |
|
Return to query results.
Submit another query.