DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34354 and CG10466

DIOPT Version :10

Sequence 1:NP_001097953.2 Gene:CG34354 / 5740528 FlyBaseID:FBgn0085383 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_610003.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster


Alignment Length:116 Identity:28/116 - (24%)
Similarity:56/116 - (48%) Gaps:1/116 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 QMSQQQQQQQQQLVGNNSKPEQFHIFVGDLSAEIETQQLKDAFTPFGEISDCRVVRDPQTLKSKG 138
            ::|:.:.|...:...::...:...|||......:....|...|:.:||:.:..::||.:|.||||
  Fly    12 KLSEHELQHGGKKSWHDMYKDSAWIFVAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKTGKSKG 76

  Fly   139 YGFVSFVKKSEAETAITAMNGQWLGSRSIRTNW-ATRKPPATKADMNAKPL 188
            :.|:.:..:.....|:..:||..:..|::|.:. |..|||.....|:.:.|
  Fly    77 FCFLCYEDQRSTVLAVDNLNGIKILDRTLRVDHVADYKPPKENEKMDEETL 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34354NP_001097953.2 PABP-1234 <90..420 CDD:130689 26/100 (26%)
RRM2_TIA1_like 97..171 CDD:409789 20/73 (27%)
RRM3_TIA1_like 202..276 CDD:409790
CG10466NP_610003.1 RRM_ist3_like 25..113 CDD:409845 21/87 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.