DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34354 and Hrb27C

DIOPT Version :9

Sequence 1:NP_001097953.2 Gene:CG34354 / 5740528 FlyBaseID:FBgn0085383 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_001162897.1 Gene:Hrb27C / 33968 FlyBaseID:FBgn0004838 Length:421 Species:Drosophila melanogaster


Alignment Length:341 Identity:85/341 - (24%)
Similarity:128/341 - (37%) Gaps:96/341 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 EQFHIFVGDLSAEIETQQLKDAFTPFGEISDCRVVRDPQTLKSKGYGFVSFVKKSEAETAITAMN 158
            |:..:|||.||.|...:.|...|..||:|.||.|:::.::.:|:|:|||:|...:.....:  .|
  Fly     5 ERGKLFVGGLSWETTQENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTNVNHVL--QN 67

  Fly   159 G-QWLGSRSIRTNWATRKPPATKADMNAKPLTFDEVYNQSSPTNCTVYCGGINGALSGFLNEEIL 222
            | ..|..|:|                :.||.....:..........|:.||    |...:.|..|
  Fly    68 GPHTLDGRTI----------------DPKPCNPRTLQKPKKGGGYKVFLGG----LPSNVTETDL 112

  Fly   223 QKTFSPYGTIQEIRVF------KDKGYAFVRFSTKEAATHAIVAVNNTEIN----QQPVKCAWGK 277
            :..|:.||.:.|:.:.      |.:|:.|:.|..:.:..|   ..|...||    |..:|.|..:
  Fly   113 RTFFNRYGKVTEVVIMYDQEKKKSRGFGFLSFEEESSVEH---VTNERYINLNGKQVEIKKAEPR 174

  Fly   278 E-SGDPNHMSAIAGGALAQGFPFGSAAAAAAAAAYGQ--QVAGYWYP-----------------P 322
            : ||..|..::..||                  |||:  ....:|.|                 |
  Fly   175 DGSGGQNSNNSTVGG------------------AYGKLGNECSHWGPHHAPINMMQGQNGQMGGP 221

  Fly   323 APTYPAAAPASALQPGQFLQGMQGFTYGQFAGYQQAGYMGMGVQLPGT---WQSVP----PQPQL 380
            ....|..||       ..:.|.||  :|.....||.||...|   ||:   |.:.|    |.||.
  Fly   222 PLNMPIGAP-------NMMPGYQG--WGTSPQQQQYGYGNSG---PGSYQGWGAPPGPQGPPPQW 274

  Fly   381 ASAAAATAPQITQSVG 396
            ::.|   .||.||..|
  Fly   275 SNYA---GPQQTQGYG 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34354NP_001097953.2 RRM2_TIA1_like 97..171 CDD:240799 25/74 (34%)
RRM3_TIA1_like 202..278 CDD:240800 21/85 (25%)
Hrb27CNP_001162897.1 RRM1_DAZAP1 8..89 CDD:241018 27/98 (28%)
RRM2_DAZAP1 94..173 CDD:240773 21/85 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464029
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.