DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34354 and Rbp9

DIOPT Version :9

Sequence 1:NP_001097953.2 Gene:CG34354 / 5740528 FlyBaseID:FBgn0085383 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_001259974.1 Gene:Rbp9 / 33498 FlyBaseID:FBgn0010263 Length:684 Species:Drosophila melanogaster


Alignment Length:449 Identity:109/449 - (24%)
Similarity:177/449 - (39%) Gaps:118/449 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 AAAAAA----AAQQQQQSVTAAHLQHNGQQQHSQQQQQQQMSQQQQQQQQQLVGNNSKPE-QFHI 98
            |||.|.    ||..|..:..||...:|.....:........:..         .||::|: :.::
  Fly    57 AAAGAGSTTNAAVGQATANNAASNNNNNNNNTNNNNNNNATANN---------NNNNEPDPKTNL 112

  Fly    99 FVGDLSAEIETQQLKDAFTPFGEISDCRVVRDPQTLKSKGYGFVSFVKKSEAETAITAMNGQWLG 163
            .|..|...:...:::..|..|||:..|:::||..|.:|.|||||::||:.:||.||.|:||..|.
  Fly   113 IVNYLPQTMSQDEIRSLFVSFGEVESCKLIRDKVTGQSLGYGFVNYVKQEDAEKAINALNGLRLQ 177

  Fly   164 SRSIRTNWATRKPPATKADMNAKPLTFDEVYNQSSPTNCTVYCGGINGALSGFLNEEILQKTFSP 228
            :::|:.:.|.   |::::...|      .:|....|.|.|               :..|:..|||
  Fly   178 NKTIKVSIAR---PSSESIKGA------NLYVSGLPKNMT---------------QSDLESLFSP 218

  Fly   229 YGTIQEIRVFKD------KGYAFVRFSTKEAATHAIVAVNNT--EINQQPVKCAWGKE-SGDPNH 284
            ||.|...|:..|      ||..|:||..:..|..||..:|.|  :.:.:|:...:... |.:.|.
  Fly   219 YGKIITSRILCDNITGLSKGVGFIRFDQRFEADRAIKELNGTTPKNSTEPITVKFANNPSSNKNS 283

  Fly   285 MSAIA---------GGALAQGFPFGSAAAAAAAAA----------YGQQVAGY------------ 318
            |..:|         ||   :.||..:||.||||||          |...::.|            
  Fly   284 MQPLAAYIAPQNTRGG---RAFPANAAAGAAAAAAAAAIHPNAGRYSSVISRYSPLTSDLITNGM 345

  Fly   319 ----------W----YPPAP------TYPAAAPASALQPGQFLQGMQ-----GFTYGQFAGYQQA 358
                      |    |..||      .:....|..|:|..:.::.:|     ||.:.....|::|
  Fly   346 IQGNTIASSGWCIFVYNLAPDTEENVLWQLFGPFGAVQSVKVIRDLQSNKCKGFGFVTMTNYEEA 410

  Fly   359 --------GY-MGMGVQLPGTWQSVPPQPQLASAAAATAPQITQSVGSALPQAAGVVAY 408
                    || :|..|.......:...|. |.:..||.   :..:..:|...|.|:|.:
  Fly   411 VLAIQSLNGYTLGNRVLQVSFKTNKNKQTXLLTKLAAV---VNANAAAAALAANGLVLH 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34354NP_001097953.2 RRM2_TIA1_like 97..171 CDD:240799 27/73 (37%)
RRM3_TIA1_like 202..278 CDD:240800 21/83 (25%)
Rbp9NP_001259974.1 ELAV_HUD_SF 107..438 CDD:273741 88/357 (25%)
RRM1_Hu 109..186 CDD:241094 27/76 (36%)
RRM2_Hu 196..274 CDD:241096 25/98 (26%)
RRM3_Hu 355..432 CDD:240823 16/76 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I3078
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.