DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34354 and tia1l

DIOPT Version :9

Sequence 1:NP_001097953.2 Gene:CG34354 / 5740528 FlyBaseID:FBgn0085383 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_956476.1 Gene:tia1l / 323447 ZFINID:ZDB-GENE-030131-2167 Length:342 Species:Danio rerio


Alignment Length:326 Identity:142/326 - (43%)
Similarity:182/326 - (55%) Gaps:51/326 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 AAAAAAQQQQQSVTAAHLQHNGQQQHSQQQQQQQMSQQQQQQQQQLVGNNSKPEQFHIFVGDLSA 105
            ||||.|....:.:....::.|.....|.|::...                   ..||:||||||.
Zfish    61 AAAALAAMNGRKILGKDMKVNWASTPSSQKKDTS-------------------NHFHVFVGDLSP 106

  Fly   106 EIETQQLKDAFTPFGEISDCRVVRDPQTLKSKGYGFVSFVKKSEAETAITAMNGQWLGSRSIRTN 170
            ||.|..::.||.|||:|||.|||:|..|.|||||||:||:.|.:||:||..|||||||.|.||||
Zfish   107 EISTDDVRAAFAPFGKISDARVVKDLATGKSKGYGFISFINKWDAESAIQQMNGQWLGGRQIRTN 171

  Fly   171 WATRKPPATKAD---MNAKPLTFDEVYNQSSPTNCTVYCGGINGALSGFLNEEILQKTFSPYGTI 232
            ||||||.|.|::   .::|.|:::||.|||||:|||||||||...||    ::::::||||:|.|
Zfish   172 WATRKPSAPKSNNEGASSKHLSYEEVLNQSSPSNCTVYCGGIASGLS----DQLMRQTFSPFGQI 232

  Fly   233 QEIRVFKDKGYAFVRFSTKEAATHAIVAVNNTEINQQPVKCAWGKESGDPNHMSAIAGGALAQGF 297
            .|||||.:|||:||||.:.|.|.||||:||.|.|....|||.||||:.|...|         |..
Zfish   233 MEIRVFPEKGYSFVRFDSHEGAAHAIVSVNGTCIEGHTVKCYWGKETADMRSM---------QQM 288

  Fly   298 PFGSA-AAAAAAAAYGQQVAGYWYPPAPTYPAAAPASALQPGQFL-QGMQGFTYGQFA-GYQQAG 359
            |.... ....||..|||....|             .:..|.||:: .|.|..|||.:. .:.|.|
Zfish   289 PMPQQNKPTYAAQPYGQWGQSY-------------GNGQQMGQYVPNGWQMPTYGVYGQAWNQQG 340

  Fly   360 Y 360
            |
Zfish   341 Y 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34354NP_001097953.2 RRM2_TIA1_like 97..171 CDD:240799 48/73 (66%)
RRM3_TIA1_like 202..278 CDD:240800 43/75 (57%)
tia1lNP_956476.1 ELAV_HUD_SF 7..272 CDD:273741 114/233 (49%)
RRM_SF 10..90 CDD:302621 7/28 (25%)
RRM2_TIA1 96..175 CDD:241062 52/78 (67%)
RRM3_TIAR 206..278 CDD:241064 43/75 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I6775
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1066369at2759
OrthoFinder 1 1.000 - - FOG0000924
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10352
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X831
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
77.020

Return to query results.
Submit another query.