DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34354 and srsf4

DIOPT Version :9

Sequence 1:NP_001097953.2 Gene:CG34354 / 5740528 FlyBaseID:FBgn0085383 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_955868.1 Gene:srsf4 / 321872 ZFINID:ZDB-GENE-030131-591 Length:366 Species:Danio rerio


Alignment Length:206 Identity:44/206 - (21%)
Similarity:77/206 - (37%) Gaps:66/206 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 IFVGDLSAEIETQQLKDAFTPFGEISDCRVVRDPQTLKSKGYGFVSFVKKSEAETAITAMNGQWL 162
            ::||.||.....:.::..|..:|:|.:.       .||: |||||.|....:|:.|:..:||:.|
Zfish     4 VYVGKLSYRAREKDVERFFKGYGKILEV-------DLKN-GYGFVEFDDPRDADDAVYDLNGKDL 60

  Fly   163 -----------------GSRSIRTN---------WATRKPPATKADMNAKPLTFDEVYNQSSPTN 201
                             |:||.|:|         ...|..|.|:.|..   |..:.:.::.|..:
Zfish    61 CGKRVIVEHTIGQRRDGGNRSGRSNRYGRGGGGGGGDRYGPPTRTDYR---LIVENLSSRCSWQD 122

  Fly   202 CTVY---CGGINGA--LSGFLNEEILQKTFSPYGTIQEIRVFKDKGYAFVRFSTKEAATHAIVAV 261
            ...|   .|.:..|  ..|..||.::           |.|.:.|             ...|:..:
Zfish   123 LKDYMRQAGEVTYADTNKGRKNEGVI-----------EFRQYSD-------------MKRALEKL 163

  Fly   262 NNTEINQQPVK 272
            :.||:|.:.::
Zfish   164 DGTEVNGRKIR 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34354NP_001097953.2 RRM2_TIA1_like 97..171 CDD:240799 25/98 (26%)
RRM3_TIA1_like 202..278 CDD:240800 13/76 (17%)
srsf4NP_955868.1 RRM1_SRSF4_like 3..72 CDD:240783 20/75 (27%)
RRM2_SRSF4_like 107..178 CDD:241044 15/95 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.