Sequence 1: | NP_001097953.2 | Gene: | CG34354 / 5740528 | FlyBaseID: | FBgn0085383 | Length: | 550 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_955868.1 | Gene: | srsf4 / 321872 | ZFINID: | ZDB-GENE-030131-591 | Length: | 366 | Species: | Danio rerio |
Alignment Length: | 206 | Identity: | 44/206 - (21%) |
---|---|---|---|
Similarity: | 77/206 - (37%) | Gaps: | 66/206 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 98 IFVGDLSAEIETQQLKDAFTPFGEISDCRVVRDPQTLKSKGYGFVSFVKKSEAETAITAMNGQWL 162
Fly 163 -----------------GSRSIRTN---------WATRKPPATKADMNAKPLTFDEVYNQSSPTN 201
Fly 202 CTVY---CGGINGA--LSGFLNEEILQKTFSPYGTIQEIRVFKDKGYAFVRFSTKEAATHAIVAV 261
Fly 262 NNTEINQQPVK 272 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG34354 | NP_001097953.2 | RRM2_TIA1_like | 97..171 | CDD:240799 | 25/98 (26%) |
RRM3_TIA1_like | 202..278 | CDD:240800 | 13/76 (17%) | ||
srsf4 | NP_955868.1 | RRM1_SRSF4_like | 3..72 | CDD:240783 | 20/75 (27%) |
RRM2_SRSF4_like | 107..178 | CDD:241044 | 15/95 (16%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |