DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34354 and ssx

DIOPT Version :9

Sequence 1:NP_001097953.2 Gene:CG34354 / 5740528 FlyBaseID:FBgn0085383 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster


Alignment Length:506 Identity:109/506 - (21%)
Similarity:170/506 - (33%) Gaps:198/506 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 QHNG--QQQHSQQQQQQQMSQQQQQQQQQLVGNNSKPEQFHIFVGDLSAEIETQQLKDAFTPFGE 121
            :|:|  :|.|||..:....|..||||.||:    .:....::.:..|..::..::|.:.|:..|.
  Fly    58 EHSGDEEQHHSQDNEGNDNSAGQQQQMQQV----DRTSATNLIINYLPQDMTDRELYNLFSGCGP 118

  Fly   122 ISDCRVVRDPQTLKSKGYGFVSFVKKSEAETAITAMNGQWLGSRSIRTNWATRKPPATKADMNAK 186
            |:.|:::||.:|..|.|||||.:..:|::|.||..:||.::.::.::.::|.....:.|      
  Fly   119 INTCKIMRDFKTGYSFGYGFVDYKTESDSEDAIQKLNGFYVRNKRLKVSYARPGGQSIK------ 177

  Fly   187 PLTFDEVYNQSSPTNCTVYCGGINGALSGFLNEEILQKTFSPYGTIQEIRVFKDK------GYAF 245
                        .||..|    ||  ||..:|:::|.:.|||||.|.:..:.:||      |.||
  Fly   178 ------------DTNLYV----IN--LSRNINDDMLDRIFSPYGLIVQRNILRDKLTGRPRGVAF 224

  Fly   246 VRFSTKEAATHAIVAVNNT--EINQQPVKCAWGKESGDPNHMSAIAGGALAQGFPFGSAAAAAAA 308
            ||::.:|.|..||.|:|||  |...||:.....:|.|                        .|.|
  Fly   225 VRYNKREEAQEAIKALNNTVPEGGSQPIWVRLAEEHG------------------------KAKA 265

  Fly   309 AAYGQQVAGYWYPPAPTYPAAAPASALQPGQFLQGMQGFTYGQFAGYQQAGYMGMGVQLPGTWQS 373
            |.:..|:.|                                |...|       |.|         
  Fly   266 AQFMAQIGG--------------------------------GNGGG-------GGG--------- 282

  Fly   374 VPPQPQLASAAAATAPQITQSVGSALPQAAGVVAYPMQQFQVSPQLAEDEWLAPSLLVXLPXGMA 438
             ||.                                               :.|        |..
  Fly   283 -PPH-----------------------------------------------MGP--------GGP 291

  Fly   439 MYPTQQHQQQQQQQQQQQMLQQQHEQQTSGEYVKEPPYQTQQLQQLQHHQLQQQHSHNQHQQQQH 503
            |:|...|............:               ||:         |||.|..|.|.||..|.|
  Fly   292 MHPPHHHNNHHHNNHHNPHM---------------PPH---------HHQPQHPHQHPQHHPQLH 332

  Fly   504 YIHQLYYPSHWVQQQQQQQQQVANNEQ-------QPQQQQQQPPVAQVYGM 547
            :: |.::|::.............||..       .|...||..|:....||
  Fly   333 HM-QHHHPNNHNNNHPNNHHHNNNNNNHHNMGGPHPHHMQQMHPMGMNMGM 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34354NP_001097953.2 RRM2_TIA1_like 97..171 CDD:240799 21/73 (29%)
RRM3_TIA1_like 202..278 CDD:240800 31/83 (37%)
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 22/79 (28%)
RRM_SF 179..257 CDD:302621 33/83 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.