DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34354 and Cstf2t

DIOPT Version :9

Sequence 1:NP_001097953.2 Gene:CG34354 / 5740528 FlyBaseID:FBgn0085383 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_001101056.1 Gene:Cstf2t / 309338 RGDID:1310026 Length:629 Species:Rattus norvegicus


Alignment Length:361 Identity:86/361 - (23%)
Similarity:128/361 - (35%) Gaps:101/361 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 IFVGDLSAEIETQQLKDAFTPFGEISDCRVVRDPQTLKSKGYGFVSFVKKSEAETAITAM---NG 159
            :|||::..|...:||||.|:..|.:...|:|.|.:|.|.|||||..:   .:.|||::||   ||
  Rat    18 VFVGNIPYEATEEQLKDIFSEVGSVVSFRLVYDRETGKPKGYGFCEY---QDQETALSAMRNLNG 79

  Fly   160 QWLGSRSIRT-NWATRKPPATKADMN----AKPLTFDEVYN-----QSSPTNCTVYCGGINGALS 214
            :....|::|. |.|:.|   .|.::.    |.|: .|..|.     :.:|.:       |..|::
  Rat    80 REFSGRALRVDNAASEK---NKEELKSLGPAAP
I-IDSPYGDPIDPEDAPES-------ITRAVA 133

  Fly   215 GFLNEEIL----QKTFSPYGTIQEIRVF----KDKGYAFVRFSTKEAATHAIVAVNNTEI----- 266
            ....|::.    |.......:.||.|..    ....||.::       ...::.:.:.||     
  Rat   134 SLPPEQMFELMKQMKLCVQNSHQEARNMLLQNPQLAYALLQ-------AQVVMRIMDPEIALKIL 191

  Fly   267 ------------NQQPVKCAWGKESGDPNHMSAIAGGALAQGFPFGSAAAAAAAAAYGQQVAGYW 319
                        ..|||.   |...|.|       ||   .|.|.|.....|.....|..|....
  Rat   192 HRKIHVTPLIPGKSQPVS---GPGPGGP-------GG---PGGPGGPGPGPAPGLCPGPNVMLNQ 243

  Fly   320 YPPAPTYPAAAPASALQ--PGQFLQGMQGFTYGQFAGYQQAGYMGMGVQLPGTW-QSVP-PQPQL 380
            ..||| .|...|...::  |......:||                 |:..||.. .:|| |.|..
  Rat   244 QNPAP-QPQHLPRRPVKDIPPLMQTSIQG-----------------GIPAPGPIPAAVPGPGPGS 290

  Fly   381 ASAAAATAPQITQSVGSALPQAAGVVAYPMQQFQVS 416
            .:......||:...|...:|...|       |.|:|
  Rat   291 LTPGGTMQPQVGMPVVGPVPLERG-------QMQIS 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34354NP_001097953.2 RRM2_TIA1_like 97..171 CDD:240799 29/76 (38%)
RRM3_TIA1_like 202..278 CDD:240800 15/100 (15%)
Cstf2tNP_001101056.1 RRM <16..>109 CDD:223796 34/96 (35%)
RRM_CSTF2_CSTF2T 18..92 CDD:241115 29/76 (38%)
CSTF2_hinge 113..191 CDD:291025 13/91 (14%)
CSTF_C 585..625 CDD:291002
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.