DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34354 and Hnrnpa1

DIOPT Version :9

Sequence 1:NP_001097953.2 Gene:CG34354 / 5740528 FlyBaseID:FBgn0085383 Length:550 Species:Drosophila melanogaster
Sequence 2:XP_006242446.1 Gene:Hnrnpa1 / 29578 RGDID:69234 Length:373 Species:Rattus norvegicus


Alignment Length:309 Identity:76/309 - (24%)
Similarity:126/309 - (40%) Gaps:68/309 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 KPEQFH-IFVGDLSAEIETQQLKDAFTPFGEISDCRVVRDPQTLKSKGYGFVSFVKKSEAETAIT 155
            :|||.. :|:|.||.|...:.|:..|..:|.::||.|:|||.|.:|:|:|||::....|.:.|:.
  Rat     9 EPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMN 73

  Fly   156 A----MNGQWLGSRSIRTNWATRKPPATKADMNAKPLTFDEVYNQSSPTNCTVYCGGINGALSGF 216
            |    ::|:.:..:...:...:::|.|        .||..:           ::.|||...    
  Rat    74 ARPHKVDGRVVEPKRAVSREDSQRPGA--------HLTVKK-----------IFVGGIKED---- 115

  Fly   217 LNEEILQKTFSPYGTIQEIRVFKD------KGYAFVRFSTKEAATHAIV----AVN--NTEI--- 266
            ..|..|:..|..||.|:.|.:..|      :|:|||.|...::....::    .||  |.|:   
  Rat   116 TEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKA 180

  Fly   267 -NQQPVKCAWGKESGDPNHMSAIAGGALAQGF----PFGSAAAAAAAAAYGQQVAGYWYPPAPT- 325
             ::|.:..|...:.|...  |...||....||    .||.....:....:|....|..|..:.. 
  Rat   181 LSKQEMASASSSQRGRSG--SGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDG 243

  Fly   326 ---------YPAAAPASALQPGQFLQGMQGF-TYGQFAGYQQAGYMGMG 364
                     |....|.       :..|.:|: :.||..|.|.:||.|.|
  Rat   244 YNGFGNDGGYGGGGPG-------YSGGSRGYGSGGQGYGNQGSGYGGSG 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34354NP_001097953.2 RRM2_TIA1_like 97..171 CDD:240799 24/78 (31%)
RRM3_TIA1_like 202..278 CDD:240800 22/91 (24%)
Hnrnpa1XP_006242446.1 RRM1_hnRNPA1 12..92 CDD:410154 25/79 (32%)
RRM2_hnRNPA3 105..184 CDD:409996 20/93 (22%)
HnRNPA1 308..345 CDD:402981
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.