DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34354 and SPBC660.15

DIOPT Version :9

Sequence 1:NP_001097953.2 Gene:CG34354 / 5740528 FlyBaseID:FBgn0085383 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_595094.1 Gene:SPBC660.15 / 2541150 PomBaseID:SPBC660.15 Length:474 Species:Schizosaccharomyces pombe


Alignment Length:405 Identity:92/405 - (22%)
Similarity:145/405 - (35%) Gaps:94/405 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PAAAAAAAAQQQQQSVTAAHLQHNGQQQHSQQQ--------QQQQMSQQQQQQQQQLVGNNSKPE 94
            |.|....:...||.|..|...|.:...:.|||.        :.|.:|.......:.  |.|||.:
pombe    68 PGADFDRSGSDQQYSAEAEANQEDDLNETSQQAPDPSSYDIRGQALSSATWDNAED--GENSKND 130

  Fly    95 QFH-------------------------------IFVGDLSAEIETQQLKDAFTPFGEISDCRVV 128
            .::                               :|:|.|:.|.....|:|.|..|||:.||.|:
pombe   131 NYNENQSALTGSGAMESNEDNAEETSPFNREDGKMFIGGLNWETTDDSLRDYFEQFGEVLDCTVM 195

  Fly   129 RDPQTLKSKGYGFVSFVKKSEAETAITA----MNGQWLGSRSIRTNWATRKPPATKADMNAKPLT 189
            ||..|.:|:|:||::| |..:....:.:    ::|:.:..:        |..|..:.:..||   
pombe   196 RDSTTGRSRGFGFLTF-KNPKCVNEVMSKEHHLDGKIIDPK--------RAIPREEQEKTAK--- 248

  Fly   190 FDEVYNQSSPTNCTVYCGGINGALSGFLNEEILQKTFSPYGTIQEIRVFKDK------GYAFVRF 248
                          ::.||:.|..:    ||..:..|:.:|.:.:..:..||      |:.||.:
pombe   249 --------------MFVGGVPGDCT----EEEFRNFFNQFGRVLDATLMMDKDTGRPRGFGFVTY 295

  Fly   249 STKEAATHAIVAVNNTEINQQP--VKCAWGKES---GDPNHMSAIAGGA---LAQGFPFGSAAAA 305
            . .|:|..|.::.....|:.:|  ||.|..|.|   ....|.....|.|   .||..........
pombe   296 E-NESAVEATMSQPYITIHGKPVEVKRATPKASLRDSHDRHQHGYHGNANPYYAQNMNMYGGMTP 359

  Fly   306 AAAAAYGQQVAGYWYPPAPTYPAAAPASALQPGQFLQGMQGFTYGQFAGYQQAGYMGMGVQLPGT 370
            |..|.|.:|:..| .......||||.|..........||..:...|   .|.|.|........||
pombe   360 AMMAQYYRQMQQY-MEAMRNMPAAAGAVPYPQPVMPAGMADWQQQQ---QQGAAYFDPSKMNQGT 420

  Fly   371 WQSVPPQPQLASAAA 385
            ...||..|.:.|.::
pombe   421 GDGVPFSPSMPSGSS 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34354NP_001097953.2 RRM2_TIA1_like 97..171 CDD:240799 23/108 (21%)
RRM3_TIA1_like 202..278 CDD:240800 20/83 (24%)
SPBC660.15NP_595094.1 RRM1_Hrp1p 165..240 CDD:241021 24/83 (29%)
RRM2_Hrp1p 248..322 CDD:240776 20/95 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.