DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34354 and SPBC23E6.01c

DIOPT Version :9

Sequence 1:NP_001097953.2 Gene:CG34354 / 5740528 FlyBaseID:FBgn0085383 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_596601.2 Gene:SPBC23E6.01c / 2540551 PomBaseID:SPBC23E6.01c Length:473 Species:Schizosaccharomyces pombe


Alignment Length:352 Identity:87/352 - (24%)
Similarity:137/352 - (38%) Gaps:96/352 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 SKPEQFHIFVGDLSAEIETQQLKDAF-TPFGEISDCRVVRDPQTLKSKGYGFVSFVKKSEAETAI 154
            ||..::.|||||||..:....:...| :.:......:::.||||..|:|||||.|..:::.::|:
pombe   181 SKASEYSIFVGDLSPNVNEFDVYSLFASRYNSCKSAKIMTDPQTNVSRGYGFVRFTDENDQKSAL 245

  Fly   155 TAMNGQWLGSRSIRTNWATRKPPATKA----DMNAKPLTFDEV--YNQSSP-------TNCTVYC 206
            ..|.||..|.|.||...||   |.:||    .:|..|::...|  |:.:.|       .|.||:.
pombe   246 AEMQGQICGDRPIRVGLAT---PKSKAHVFSPVNVVPVSMPPVGFYSAAQPVPQFADTANSTVFV 307

  Fly   207 GGINGALSGFLNEEILQKTFSPYGTIQEIRVFKDKGYAFVRFSTKEAATHAIVAVNNTEINQQPV 271
            ||    ||.|::||.|:..|..:|.|..:::...||..||:|..:::|..||..:....:....:
pombe   308 GG----LSKFVSEEELKYLFQNFGEIVYVKIPPGKGCGFVQFVNRQSAEIAINQLQGYPLGNSRI 368

  Fly   272 KCAWGKESGDPNHMSAIAGGALAQGFPFGSAAAAAAAAAYGQQVAGYWYPPAPTYPAAAPASALQ 336
            :.:||:...                      ..||.|..|..||:....|....:||        
pombe   369 RLSWGRNQN----------------------PIAAPALNYQSQVSQTTIPATSLFPA-------- 403

  Fly   337 PGQFLQGMQGFTYGQFAGYQQAGYMGMGVQLPGTWQSVPPQPQLAS-AAAATAPQITQSVGSALP 400
                                               .|:|||.|.:. .|.|.:|...|:.|:.:.
pombe   404 -----------------------------------MSLPPQAQFSPYPAVAPSPLALQTRGAPIG 433

  Fly   401 QAAGVVAYPMQQFQVSPQLAEDEWLAP 427
            ....:         .||.|..|:...|
pombe   434 MEISI---------GSPALVPDQMHIP 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34354NP_001097953.2 RRM2_TIA1_like 97..171 CDD:240799 27/74 (36%)
RRM3_TIA1_like 202..278 CDD:240800 23/75 (31%)
SPBC23E6.01cNP_596601.2 RRM 70..376 CDD:223796 63/201 (31%)
RRM1_NGR1_NAM8_like 94..173 CDD:241055
RRM2_NGR1_NAM8_like 185..264 CDD:241057 27/78 (35%)
RRM3_NGR1_NAM8_like 302..373 CDD:240792 22/74 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 112 1.000 Inparanoid score I1562
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.