DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34354 and Tia1

DIOPT Version :9

Sequence 1:NP_001097953.2 Gene:CG34354 / 5740528 FlyBaseID:FBgn0085383 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_035715.1 Gene:Tia1 / 21841 MGIID:107914 Length:386 Species:Mus musculus


Alignment Length:394 Identity:166/394 - (42%)
Similarity:206/394 - (52%) Gaps:89/394 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 AAAAAAQQQQQSVTAAHLQHNGQQQHSQQQQQQQMSQQQQQQQQQLVGNNSKPEQFHIFVGDLSA 105
            ||||.|....:.:....::.|.....|.|::....|.....|:.|        :.||:||||||.
Mouse    59 AAAALAAMNGRKIMGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQ--------DHFHVFVGDLSP 115

  Fly   106 EIETQQLKDAFTPFGEISDCRVVRDPQTLKSKGYGFVSFVKKSEAETAITAMNGQWLGSRSIRTN 170
            ||.|:.:|.||.|||.|||.|||:|..|.||||||||||..|.:||.||..|.|||||.|.||||
Mouse   116 EITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTN 180

  Fly   171 WATRKPPATKA--DMNAKPLTFDEVYNQSSPTNCTVYCGGINGALSGFLNEEILQKTFSPYGTIQ 233
            ||||||||.|:  :.|.|.|::|||.:||||.||||||||:...|:    |:::::||||:|.|.
Mouse   181 WATRKPPAPKSTYESNTKQLSYDEVVSQSSPNNCTVYCGGVTSGLT----EQLMRQTFSPFGQIM 241

  Fly   234 EIRVFKDKGYAFVRFSTKEAATHAIVAVNNTEINQQPVKCAWGKESGD-------PNHMSAIAGG 291
            |||||.||||:|||||:.|:|.||||:||.|.|....|||.||||:.|       .|.:      
Mouse   242 EIRVFPDKGYSFVRFSSHESAAHAIVSVNGTTIEGHVVKCYWGKETLDMINPVQQQNQI------ 300

  Fly   292 ALAQGFPFGSAAAAAAAAAYGQQVAGYWYPPAPTYPAAAPASALQPGQFL-QGMQGFTYGQFA-- 353
                |:|          ..|||.  |.||           .:|.|.||:: .|.|...||.:.  
Mouse   301 ----GYP----------PTYGQW--GQWY-----------GNAQQIGQYVPNGWQVPAYGVYGQP 338

  Fly   354 ----GYQQ----AGYMGMGVQLPGTWQSVPPQPQLASAAAATAPQITQSVGSALP-QAAG--VVA 407
                |:.|    |.:||....:|      |||.|               .||.|| |.||  |..
Mouse   339 WSQQGFNQTQSSAPWMGPNYSVP------PPQGQ---------------NGSMLPSQPAGYRVAG 382

  Fly   408 YPMQ 411
            |..|
Mouse   383 YETQ 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34354NP_001097953.2 RRM2_TIA1_like 97..171 CDD:240799 49/73 (67%)
RRM3_TIA1_like 202..278 CDD:240800 44/75 (59%)
Tia1NP_035715.1 ELAV_HUD_SF 6..280 CDD:273741 121/232 (52%)
RRM1_TIA1 8..81 CDD:241059 6/21 (29%)
RRM2_TIA1 105..184 CDD:241062 53/78 (68%)
RRM3_TIA1 214..287 CDD:241065 45/76 (59%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 355..376 11/41 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 99 1.000 Domainoid score I7056
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000924
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10352
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X831
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
77.010

Return to query results.
Submit another query.