DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34354 and rnp-9

DIOPT Version :9

Sequence 1:NP_001097953.2 Gene:CG34354 / 5740528 FlyBaseID:FBgn0085383 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_001359585.1 Gene:rnp-9 / 182350 WormBaseID:WBGene00007396 Length:312 Species:Caenorhabditis elegans


Alignment Length:277 Identity:106/277 - (38%)
Similarity:148/277 - (53%) Gaps:32/277 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PHKPPETKLL-----------AIHPAAAAAAAAQQQ-------QQSVTAAHLQHNGQQQHSQQQQ 71
            |...|:|.||           :..||......:.|.       .|:.:...|.|.| ..||.:..
 Worm     4 PTATPQTSLLYSQQMPMKNLYSQFPAGLLDTQSIQSLDTCPLLLQTASLPSLSHIG-LPHSLESA 67

  Fly    72 QQQMSQQQQQQQQQLVGNNSKPEQFHIFVGDLSAEIETQQLKDAFTPFGEISDCRVVRDPQTLKS 136
            ....:.:...:.:.   :.||  .||:||||||.::..:.||..||.|||:|:.:|:||.||.||
 Worm    68 VLHSASEPPMEMRI---DTSK--HFHVFVGDLSKDVSNELLKSTFTKFGEVSEAKVIRDVQTQKS 127

  Fly   137 KGYGFVSFVKKSEAETAITAMNGQWLGSRSIRTNWATRKPPATKADMNAKPLTFDEVYNQSSPTN 201
            ||||||||..|..||.||..|||:|:|.|::|||||.||    .::.|...|||::|:|.:...|
 Worm   128 KGYGFVSFPNKQNAENAIAGMNGKWIGKRAVRTNWAARK----NSEENRDKLTFEQVFNSTKADN 188

  Fly   202 CTVYCGGINGALSGFLNEEILQKTFSPYGTIQEIRVFKDKGYAFVRFSTKEAATHAIVAVNNTEI 266
            .:||.|.|    |....:..|:..||.||.|.|:|:||.:.|||||:..||.||.||:.:|..|:
 Worm   189 TSVYVGNI----SQQTTDADLRDLFSTYGDIAEVRIFKTQRYAFVRYEKKECATKAIMEMNGKEM 249

  Fly   267 NQQPVKCAWGKESGDPN 283
            ....|:|:||:....||
 Worm   250 AGNQVRCSWGRTQAVPN 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34354NP_001097953.2 RRM2_TIA1_like 97..171 CDD:240799 43/73 (59%)
RRM3_TIA1_like 202..278 CDD:240800 32/75 (43%)
rnp-9NP_001359585.1 RRM2_TIA1_like 88..162 CDD:240799 43/73 (59%)
RRM3_TIA1_like 189..260 CDD:240800 31/74 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I7055
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1066369at2759
OrthoFinder 1 1.000 - - FOG0000924
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.