DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34354 and tiar-1

DIOPT Version :9

Sequence 1:NP_001097953.2 Gene:CG34354 / 5740528 FlyBaseID:FBgn0085383 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_495121.1 Gene:tiar-1 / 173967 WormBaseID:WBGene00015943 Length:408 Species:Caenorhabditis elegans


Alignment Length:366 Identity:129/366 - (35%)
Similarity:188/366 - (51%) Gaps:71/366 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 NGQQQHSQQQQQQQMSQQQQ----------QQQQQLVGNNSKPEQFHIFVGDLSAEIETQQLKDA 115
            :||...:.|...:::...::          |||.::    .....||:||||||:|::.|:|::|
 Worm    94 HGQASQALQTMNKRLLLDREMKVNWAVEPGQQQSKI----DTTRHFHVFVGDLSSEVDNQKLREA 154

  Fly   116 FTPFGEISDCRVVRDPQTLKSKGYGFVSFVKKSEAETAITAMNGQWLGSRSIRTNWATRKPPATK 180
            |.|||::||.:|:||..|.|||||||||:.|:.|||.||..|||||||.|:||||||||||...:
 Worm   155 FQPFGDVSDAKVIRDTNTTKSKGYGFVSYPKREEAERAIEQMNGQWLGRRTIRTNWATRKPGDQE 219

  Fly   181 ADMNAKPLTFDEVYNQSSPTNCTVYCGGINGALSGFLNEEILQKTFSPYGTIQEIRVFKDKGYAF 245
            ...:....::||:|||:|..|.:||.|.|     ..|.|:.:::.|:.:|.|.|:|:||.:||||
 Worm   220 KPSHYNEKSYDEIYNQTSGDNTSVYVGNI-----ASLTEDEIRQGFASFGRITEVRIFKMQGYAF 279

  Fly   246 VRFSTKEAATHAIVAVNNTEINQQPVKCAWGKESGDPNHMSAIAGGALAQGFPFGSAAAAAAAAA 310
            |:|..|:||..|||.:||.::..|.|:|:||| :||   .....||  :.|:.:|::::...:..
 Worm   280 VKFDNKDAAAKAIVQMNNQDVGGQLVRCSWGK-TGD---TGKTPGG--SYGYGYGNSSSGGNSQP 338

  Fly   311 YGQQVAGYWYPPAPTYPAAAPASALQPGQFLQGMQGFTYGQFAGYQQAGYMGMGVQLPGT----W 371
            |    :||.                         .|..||  .|....|:.|.|.|....    |
 Worm   339 Y----SGYG-------------------------GGGAYG--GGQGGGGHGGPGQQQSNANSQYW 372

  Fly   372 QSVPPQPQLASAAAATAPQITQSVGSALPQAAGVVAYPMQQ 412
            |..        |.....||:.|...:...|..|.   |.||
 Worm   373 QYY--------AQYYNNPQLMQQWSNYWQQQGGA---PQQQ 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34354NP_001097953.2 RRM2_TIA1_like 97..171 CDD:240799 47/73 (64%)
RRM3_TIA1_like 202..278 CDD:240800 32/75 (43%)
tiar-1NP_495121.1 PABP-1234 47..>302 CDD:130689 95/216 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 106 1.000 Domainoid score I4102
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1066369at2759
OrthoFinder 1 1.000 - - FOG0000924
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X831
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.