DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34354 and DAZL

DIOPT Version :9

Sequence 1:NP_001097953.2 Gene:CG34354 / 5740528 FlyBaseID:FBgn0085383 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_001177740.1 Gene:DAZL / 1618 HGNCID:2685 Length:315 Species:Homo sapiens


Alignment Length:208 Identity:40/208 - (19%)
Similarity:75/208 - (36%) Gaps:47/208 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 MPAPTIAMGAPQITMGPHKPPETKLLAIHPAAAAAAAAQQQQQSVTAAHLQHNGQQQHSQQQQQQ 73
            |.||:.. |..:..:.|..|.|:......|.:..:..|..|..|...                  
Human     1 MAAPSCG-GDRKARLTPSLPHESTANPETPNSTISREASTQSSSAAT------------------ 46

  Fly    74 QMSQQQQQQQQQLVGNNSKPEQFHIFVGDLSAEIETQQLKDAFTPFGEISDCRVVRDPQTLKSKG 138
              ||.....:.:::.|.       :|||.:...::..:::..|..:|.:.:.:::.| :|..|||
Human    47 --SQGYILPEGKIMPNT-------VFVGGIDVRMDETEIRSFFARYGSVKEVKIITD-RTGVSKG 101

  Fly   139 YGFVSFVKKSEAETAITAMNGQWLGSRSIRTNWATRKPPATKADMNAKPLTFD------------ 191
            ||||||....:.:..:.:...  ...:.::...|.||.......:..:||.|:            
Human   102 YGFVSFFNDVDVQKIVESQIN--FHGKKLKLGPAIRKQNLCAYHVQPRPLVFNHPPPPQFQNVWT 164

  Fly   192 ----EVYNQSSPT 200
                |.|.|.:.|
Human   165 NPNTETYMQPTTT 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34354NP_001097953.2 RRM2_TIA1_like 97..171 CDD:240799 16/73 (22%)
RRM3_TIA1_like 202..278 CDD:240800
DAZLNP_001177740.1 RRM_DAZL 55..136 CDD:241116 18/90 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.