Sequence 1: | NP_001097953.2 | Gene: | CG34354 / 5740528 | FlyBaseID: | FBgn0085383 | Length: | 550 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001177740.1 | Gene: | DAZL / 1618 | HGNCID: | 2685 | Length: | 315 | Species: | Homo sapiens |
Alignment Length: | 208 | Identity: | 40/208 - (19%) |
---|---|---|---|
Similarity: | 75/208 - (36%) | Gaps: | 47/208 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 MPAPTIAMGAPQITMGPHKPPETKLLAIHPAAAAAAAAQQQQQSVTAAHLQHNGQQQHSQQQQQQ 73
Fly 74 QMSQQQQQQQQQLVGNNSKPEQFHIFVGDLSAEIETQQLKDAFTPFGEISDCRVVRDPQTLKSKG 138
Fly 139 YGFVSFVKKSEAETAITAMNGQWLGSRSIRTNWATRKPPATKADMNAKPLTFD------------ 191
Fly 192 ----EVYNQSSPT 200 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG34354 | NP_001097953.2 | RRM2_TIA1_like | 97..171 | CDD:240799 | 16/73 (22%) |
RRM3_TIA1_like | 202..278 | CDD:240800 | |||
DAZL | NP_001177740.1 | RRM_DAZL | 55..136 | CDD:241116 | 18/90 (20%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |