DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34354 and SRSF10

DIOPT Version :10

Sequence 1:NP_001097953.2 Gene:CG34354 / 5740528 FlyBaseID:FBgn0085383 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_473357.1 Gene:SRSF10 / 10772 HGNCID:16713 Length:262 Species:Homo sapiens


Alignment Length:97 Identity:27/97 - (27%)
Similarity:48/97 - (49%) Gaps:5/97 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 KPEQFHIFVGDLSAEIETQQLKDAFTPFGEISDCRVVRDPQTLKSKGYGFVSFVKKSEAETAITA 156
            :|....:||.:::.:..::.|:..|..:|.|.|..|..|..|.:.:|:.:|.|....:||.|:..
Human     6 RPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHN 70

  Fly   157 MNGQWLGSRSIRTNWA--TRKPPATKADMNAK 186
            ::.:|:..|.|...:|  .||.|   ..|.||
Human    71 LDRKWICGRQIEIQFAQGDRKTP---NQMKAK 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34354NP_001097953.2 PABP-1234 <90..420 CDD:130689 27/97 (28%)
RRM2_TIA1_like 97..171 CDD:409789 19/73 (26%)
RRM3_TIA1_like 202..276 CDD:409790
SRSF10NP_473357.1 RRM_SF 5..99 CDD:473069 25/95 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..262
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.