DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34354 and LOC100490872

DIOPT Version :9

Sequence 1:NP_001097953.2 Gene:CG34354 / 5740528 FlyBaseID:FBgn0085383 Length:550 Species:Drosophila melanogaster
Sequence 2:XP_002932728.2 Gene:LOC100490872 / 100490872 -ID:- Length:449 Species:Xenopus tropicalis


Alignment Length:316 Identity:72/316 - (22%)
Similarity:112/316 - (35%) Gaps:130/316 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 QQQMSQQQQQQQQQLVGNNSKPEQFH--------IFVGDLSAEIETQQLKDAFTPFGEISDCRVV 128
            |.::.:::|.:      .:.|||..|        ::|.:||.||:..:|...|.|||.|:..:|:
 Frog   110 QAKIKEKRQTE------FSKKPEPLHKPRYNSVNLYVKNLSYEIDDYRLNKEFAPFGIITSAKVM 168

  Fly   129 RDPQTLKSKGYGFVSFVKKSEAETAITAMNGQWLGSRSIRTNWATRKP----------------- 176
            |:..  :|||:|||.|...:||..|::.|||:.|.|:.:...||.||.                 
 Frog   169 REGG--RSKGFGFVCFSTPAEARKALSGMNGKILASKPLYVAWAQRKQERQVSLAQQYTQRMEKA 231

  Fly   177 --PATKADMNAKPLT------FDEVYNQSSPTNCTVYCGGINGALSGFLNEEILQKTFSPYGTIQ 233
              |.||.:.|...|:      .....|.|..:.|.:                       |..|.|
 Frog   232 WIPNTKVNPNQALLSRCSMAPIPAAQNHSEDSLCRI-----------------------PKQTAQ 273

  Fly   234 EIRVFKDKGY----------------AFVRFSTKEAATHAIV----AVN---------------- 262
                ||.:.|                |..:.||::   :.::    |||                
 Frog   274 ----FKQRCYRNAQGTAPHSFQYMPRAHPQISTRK---YKLIPTKTAVNLVRGIMSATSRNKYAA 331

  Fly   263 ---NTEIN---------QQPVKCAWGKE--------SGDPNHMSAIAGGALAQGFP 298
               |||::         |.|..|..|:|        |..|:....:.|..|   ||
 Frog   332 GDCNTELHSEKQTQAAMQHPAICVQGQEPLTISLLVSASPHEQKQMLGVRL---FP 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34354NP_001097953.2 RRM2_TIA1_like 97..171 CDD:240799 29/81 (36%)
RRM3_TIA1_like 202..278 CDD:240800 20/123 (16%)
LOC100490872XP_002932728.2 PABP-1234 <7..431 CDD:130689 72/316 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.