DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44837 and DPEP3

DIOPT Version :9

Sequence 1:NP_001287037.1 Gene:CG44837 / 5740513 FlyBaseID:FBgn0266100 Length:964 Species:Drosophila melanogaster
Sequence 2:NP_001357127.1 Gene:DPEP3 / 64180 HGNCID:23029 Length:488 Species:Homo sapiens


Alignment Length:364 Identity:162/364 - (44%)
Similarity:226/364 - (62%) Gaps:24/364 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   604 ILREVPLVDGHNNYAWNVRKYAHSSLELHLSHDVDHKSLWSRPAWAQTDMERLKQGLVSVQVWSA 668
            ::|..|||||||:....:|:...:.|:     ||:.::.    :..||.::||:.|||..|.|||
Human    87 LMRSFPLVDGHNDLPQVLRQRYKNVLQ-----DVNLRNF----SHGQTSLDRLRDGLVGAQFWSA 142

  Fly   669 YVPCEAQGLDAVQLALEQIDIVRRLSDMYARETVLATSSQDIVDAHRRGLLASLIGVEGGHTIGS 733
            .|.|::|...||:|||||||::.|:...|: |..|.||::.:..:.:   ||.||||||||::.|
Human   143 SVSCQSQDQTAVRLALEQIDLIHRMCASYS-ELELVTSAEGLNSSQK---LACLIGVEGGHSLDS 203

  Fly   734 SLGVLRSFYSLGARYLSLTHRCDVSWAGSSAS------PAEQGLTPFGKAIVREMNRLGMMIDLS 792
            ||.||||||.||.|||:||..|...||.||..      ....|||.||:.:|.|:||||||||||
Human   204 SLSVLRSFYVLGVRYLTLTFTCSTPWAESSTKFRHHMYTNVSGLTSFGEKVVEELNRLGMMIDLS 268

  Fly   793 HSSDATARDVLQVTRAPVIFSHSAARQLCNSTRNVPDDILRLVAENGGLIMLSFDSEDVACGRQA 857
            ::||...|.||:|::|||||||||||.:|::..|||||||:|:.:|||::|::.....:.|...|
Human   269 YASDTLIRRVLEVSQAPVIFSHSAARAVCDNLLNVPDDILQLLKKNGGIVMVTLSMGVLQCNLLA 333

  Fly   858 RLQDVIEHIKYVRAIAGIQHIGLGAGYDGIELPPLGLEDVSKYPELLAALLEDHNWSEEDVAMLA 922
            .:..|.:|..::||:.|.:.||:|..|||....|.||||||.||.|:..|| ..:||||::..:.
Human   334 NVSTVADHFDHIRAVIGSEFIGIGGNYDGTGRFPQGLEDVSTYPVLIEELL-SRSWSEEELQGVL 397

  Fly   923 GRNFLRIMETVETVRDYWKRAAIQPIEQTEP--QPKTQC 959
            ..|.||:...||.||:  :..|..|:|...|  |..|.|
Human   398 RGNLLRVFRQVEKVRE--ESRAQSPVEAEFPYGQLSTSC 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44837NP_001287037.1 rDP_like 609..929 CDD:238626 149/325 (46%)
DPEP3NP_001357127.1 Peptidase_M19 87..407 CDD:395996 151/333 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155227
Domainoid 1 1.000 326 1.000 Domainoid score I1182
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H23357
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1272387at2759
OrthoFinder 1 1.000 - - FOG0001225
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102004
Panther 1 1.100 - - O PTHR10443
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.