DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44837 and SPAC3A11.10c

DIOPT Version :9

Sequence 1:NP_001287037.1 Gene:CG44837 / 5740513 FlyBaseID:FBgn0266100 Length:964 Species:Drosophila melanogaster
Sequence 2:NP_594193.1 Gene:SPAC3A11.10c / 2543080 PomBaseID:SPAC3A11.10c Length:409 Species:Schizosaccharomyces pombe


Alignment Length:407 Identity:151/407 - (37%)
Similarity:221/407 - (54%) Gaps:48/407 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   550 PDGGQKGRRGSWLVAITLVSAICLLAIAATLAYQHFLMAPSRNSHAQRLRIVRRILREVPLVDGH 614
            |...||.||...|....|::|:.|.|: ..|....::..|.|.:|.        :|...||:|||
pombe    12 PVNQQKPRRRRILKVHLLIAALILSAV-GYLGKGKWIWTPERKAHF--------VLTHFPLIDGH 67

  Fly   615 NNYAWNVRKYAHSSLELHLSHDVDHK----SLWSRPAWAQTDMERLKQGLVSVQVWSAYVPCEAQ 675
            |:            |.::|..:.|::    ||...|  .|||:.||:||.|..|.||.:|.|.: 
pombe    68 ND------------LPIYLRENYDNRLLNISLEHLP--GQTDIFRLRQGHVGGQFWSVFVECPS- 117

  Fly   676 GLD--------------AVQLALEQIDIVRRLSDMYARETVLATSSQDIVDAHRRGLLASLIGVE 726
             ||              ||...|:|||:|:|::..|.:...|...|..:.....|..::|::|:|
pombe   118 -LDSNSSLSWNRTGEYEAVTQTLQQIDVVKRMALYYPKTFSLTDHSGKVKFDFLRNHISSMMGIE 181

  Fly   727 GGHTIGSSLGVLRSFYSLGARYLSLTHRCDVSWAGSS--ASPAEQGLTPFGKAIVREMNRLGMMI 789
            |.|.|..|..:||.||.||.||.:|.|.||..:|.::  .....:||:|.|:.||||||||||::
pombe   182 GLHQIAGSPSILRQFYDLGVRYATLAHNCDNVFADAAVDGKRTNKGLSPAGRDIVREMNRLGMIV 246

  Fly   790 DLSHSSDATARDVLQVTRAPVIFSHSAARQLCNSTRNVPDDILRLVAENGGLIMLSFDSEDVA-C 853
            ||||::..|....|.|:.||..||||:|:.:.:..||||||:|..|.|..|::|::|....:: .
pombe   247 DLSHTTPETMHQALDVSVAPAFFSHSSAKGVYDHPRNVPDDVLIRVKETDGVVMVNFYPAFISPH 311

  Fly   854 GRQARLQDVIEHIKYVRAIAG-IQHIGLGAGYDGIELPPLGLEDVSKYPELLAALLEDHNWSEED 917
            ...|.:..|:|||.::..:.| .:|||||..:|||::.|.|||||||||:|...|.| ...|..:
pombe   312 PENATIDTVVEHIMHIANVTGSYRHIGLGGDFDGIDMVPKGLEDVSKYPDLFVKLAE-RGLSITE 375

  Fly   918 VAMLAGRNFLRIMETVE 934
            :|.:||||.||:.:|.|
pombe   376 LADIAGRNVLRVWKTTE 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44837NP_001287037.1 rDP_like 609..929 CDD:238626 133/341 (39%)
SPAC3A11.10cNP_594193.1 Peptidase_M19 57..389 CDD:279569 135/348 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001225
OrthoInspector 1 1.000 - - mtm9317
orthoMCL 1 0.900 - - OOG6_102004
Panther 1 1.100 - - O PTHR10443
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.