DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44837 and SPCC965.12

DIOPT Version :9

Sequence 1:NP_001287037.1 Gene:CG44837 / 5740513 FlyBaseID:FBgn0266100 Length:964 Species:Drosophila melanogaster
Sequence 2:NP_001342728.1 Gene:SPCC965.12 / 2539107 PomBaseID:SPCC965.12 Length:416 Species:Schizosaccharomyces pombe


Alignment Length:390 Identity:143/390 - (36%)
Similarity:215/390 - (55%) Gaps:46/390 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   580 LAYQHFLMAPSRNSHAQRLRIVRRILREVPLVDGHNNYAWNVRKYAHSSLELHLSHDVDHKSLWS 644
            ||.|.|                :.|.:...:||.||::.:.:|....:.|:| ...|.:: .|.|
pombe    11 LAQQRF----------------KEICKHAKIVDTHNDFPYLLRVQLRNKLQL-AEFDFEN-GLTS 57

  Fly   645 RPAWAQTDMERLKQGLVSVQVWSAYVPCE-----AQGLD----AVQLALEQIDIVRRLSDMYARE 700
                 .||:.:::||.|.||.:|.::.|:     .|..|    .|:..|||||:.|||...|..:
pombe    58 -----HTDLVKMRQGQVGVQFFSCFIECKNPNYLYQDFDTPTTVVRDTLEQIDVTRRLVCKYNND 117

  Fly   701 TVLATSSQDIVDAHR-RGLLASLIGVEGGHTIGSSLGVLRSFYSLGARYLSLTHRCDVSWAGSSA 764
            ......:.|.:.|.| .|.:|..:||||.|.:.:||.|||.:||||.||::|||.||..:|.:::
pombe   118 LKFVDCADDAIAAFRNNGKIAIALGVEGLHQVDTSLAVLRQYYSLGVRYITLTHNCDNPFATAAS 182

  Fly   765 SPA----EQGLTPFGKAIVREMNRLGMMIDLSHSSDATARDVLQVTRAPVIFSHSAARQLCNSTR 825
            |..    ::||:.:|...:.||||||||:||||.|..|..|.|.||:||||||||:|..|....|
pombe   183 SITGGLPDRGLSAYGIECIFEMNRLGMMVDLSHVSHRTMHDALDVTKAPVIFSHSSAYTLTEHER 247

  Fly   826 NVPDDILRLVAENGGLIMLSFDSEDV--ACGRQARLQDVIEHIKYVRAIAGIQHIGLGAGYDGIE 888
            ||.||:|..:..|||::.::|..:.:  ....:|.:.|..:||.::..:||.:|:|||:.:|||.
pombe   248 NVRDDVLERLKTNGGVVQVNFYQDFIRKPGSDRATIDDAADHILHIIKVAGWEHVGLGSDFDGIP 312

  Fly   889 LPPLGLEDVSKYPELLAALLEDHNWSEEDVAMLAGRNFLRIMETVETVRDYWKRAAIQPIEQTEP 953
            ..|.|||||||||:|:..::|..|.:.|.:..|.|.|.||:.:..|.|       |:|..::.||
pombe   313 QGPKGLEDVSKYPDLICKIIERTNATNEQIEGLMGLNVLRVWKKTELV-------ALQLSKKLEP 370

  Fly   954  953
            pombe   371  370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44837NP_001287037.1 rDP_like 609..929 CDD:238626 131/335 (39%)
SPCC965.12NP_001342728.1 Peptidase_M19 18..356 CDD:279569 133/344 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 262 1.000 Domainoid score I361
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001225
OrthoInspector 1 1.000 - - mtm9317
orthoMCL 1 0.900 - - OOG6_102004
Panther 1 1.100 - - O PTHR10443
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.